SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017685 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017685
Domain Number 1 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 44-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-22
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 3 Region: 157-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 356-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 396-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000887
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017685   Gene: ENSORLG00000014106   Transcript: ENSORLT00000017686
Sequence length 446
Comment pep:novel chromosome:MEDAKA1:13:27690815:27712644:-1 gene:ENSORLG00000014106 transcript:ENSORLT00000017686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STTDEETDPQNTDQRKRRHRSHVQSVDTSHMSESLCHSDECDKSFSCVSHLKTHIRTHTG
EKPFLCKECDKSFSCVSNLKRHIRTHGGEKPFSCKECNKSFKCLSNLKTHIRTHTGEKPF
SCQGCDKSFSCLSHLKRHVGTHGGEKPFSCKECDKGFNCLSNLKRHMRTHTGERPFSCKE
CDKSFSCISHLKRHLGTHTGERPFSCKECSKCFSRVFDLKRHMRTHTGEKPFLCKECDKS
FMYLSHLRRHFRTYTRTHSGVKPHSCKECGKSFTCVSHLKTHIRTHTGEKPFLCKECDKS
FTCVSHLKTHIRIHTGEKPFLCKECDKSFRSVSNLKRHMRTHGGEKPFSCKECDKSFKCL
SNLKTHIRTHTGEKPFLCKGCDKSFSSSYHLKRHIRTHTGEKPFLCKGECDKSFSCSSHL
KRHLRTHTGEKPFLYNVQFLLVDFSQ
Download sequence
Identical sequences H2MGE9
8090.ENSORLP00000017685 ENSORLP00000017685 ENSORLP00000017685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]