SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018044 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018044
Domain Number 1 Region: 48-125
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000811
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018044   Gene: ENSORLG00000014397   Transcript: ENSORLT00000018045
Sequence length 437
Comment pep:known chromosome:MEDAKA1:5:27364071:27366154:-1 gene:ENSORLG00000014397 transcript:ENSORLT00000018045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPGAQPPLSKLQTDLSDMQSFLSSSIDFPMYVYKPRRGMKRGEETKDTYKLPHRLIE
KKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKTLTSLLEQQQQKILAL
QSGMQIGEQSEQPPVNQEKSEEMFRSGFHMCAKEILHYLAAHESSGDFTPSHVISHLHKV
AAEVLQGPVRPRTPLSPRPSEAPAYHPHDLHKEKPDNLPPKPSEGYGKNCVPVIQRAYAP
PSGEQSGSDTDTDSGYGGELEKPESRVQQGHQEYYGQENQQKRSHADRQNSSIKQEDDEP
CHKQPRIESSEDELLSGGESSTSSSSSGYSSYMSVSPNHPPPPPHPLCMPFYLIPPSAAA
YLPMLEKCWYPGAVPMLYPGMGGSSPTMPSERPSPPQLVLSPRGGSPAPAISQTPMDSPA
LLQALKQVPPLNLETKE
Download sequence
Identical sequences H2MHD9
8090.ENSORLP00000018044 ENSORLP00000018044 ENSORLP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]