SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018105 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018105
Domain Number 1 Region: 46-165
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.89e-30
Family Hormone receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 124-422
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000101
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018105   Gene: ENSORLG00000014452   Transcript: ENSORLT00000018106
Sequence length 481
Comment pep:novel chromosome:MEDAKA1:21:17194237:17203596:-1 gene:ENSORLG00000014452 transcript:ENSORLT00000018106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEWKLDRFGWNWMVALVLLSSPTILQVKPSPDVNESQHQPTNVYHDIGVTRNKIVTAQF
ECYQKIMKENTHSRQGIEAMCNRTWDGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKI
CTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFF
HFKRSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLF
GCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIARSYYYNDNCW
ISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVP
LLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYN
IQFGSSIGNHSDALRSASYTASSITEVQGCYSIDGHTEHMNGKSCHDTEHASMLKSDSPF
A
Download sequence
Identical sequences H2MHJ6
8090.ENSORLP00000018105 ENSORLP00000018105 ENSORLP00000018105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]