SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018617 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018617
Domain Number 1 Region: 1381-1431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000803
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 1436-1491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 1476-1528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000238
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 483-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000856
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000106
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 1338-1397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 203-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000027
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 8 Region: 1508-1564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000569
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 9 Region: 260-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000313
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 10 Region: 1222-1275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000573
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 11 Region: 1191-1237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000975
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018617
Domain Number - Region: 1283-1325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00221
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 869-920
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00485
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 554-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00629
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 385-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00952
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 1156-1179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0523
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018617   Gene: ENSORLG00000014849   Transcript: ENSORLT00000018618
Sequence length 1602
Comment pep:novel chromosome:MEDAKA1:21:18341663:18350105:1 gene:ENSORLG00000014849 transcript:ENSORLT00000018618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSQCNQVFGKPAALKRHFKVNHREPHIKHLFEQGCQFSSSSANRQEYQSHLTSKHGLDLI
PCTSPSCTWAFPTREEMEGHRESHLPFGCFCCPFVAKSAKALRDHLVDCNRLYNNPEGTQ
NRYTNSFSFLLIEYVENCVRILPSFLGSQTKSTPTPKGPKRSKRKLESPSVSSSLHDGHV
LERKKTPFKLKKYLAEGAESVYRTHTCPKCRRCFKMRSHLQEHLRLHFPDPSLQCPTCQR
FFTSRTKLRVHRLREAGEKTQCCSMCEYTAVERNAIRRHLASVHTDEAECVAKNPSFVCP
SCGKNFTQARALKAHMKTHNIPSDSRSLACFHEGCSFQTFLRKELIIHAAEMHGVKAVEC
RHHACAAIFQSEAHMEAHHQKHLAYHCTECEFSCSNKTVFLRHQRDGHPGKEELCCSFCS
FVTFNPVEFEQHLGHLHANEKIHHCSQCSYSTSHKRGLKRHMLMHSGEKPHKCTLCDFRC
RDESYLSKHMLTHSDDKNFMCSECGYVTKWKHYLTVHMRKHAGDLRYSCDQCQYRCHRPD
QLTSHKLRHQAKSLMCEVCAYTCKRKSELRNHMLAKHSVGEKHLAVHKCKYCAYSTLHRQ
ALQNHENCKHTKLKEFHCALCVYSSFSSISLFLHKKKAHDYVPGDKKWLENYAAKEKERA
AAELLQDFYMKPTLDPDQSEESSLMEPASSGAPDRRESAEHYQSWESTATPLPVDSVVDV
VPQEDSHQYVSDGPPERYCTLVLSTLTSTTSSSLEENCESTPTLYDNKSHALQENVNFST
LMSSSEEDSAAVQTGACEQKDSEDSCEHLIDASPPVKHTECQISTPEEENSTLQHNMHLK
AMKKHDMDQAETMVPEGHVKMLVVQSETTYQCDKCSYVTCKERAFRHHHQALCHKKMKEH
TCQTCGVQFKQRRGLHNHLRRTCPSHSRKAFLQDSNPCQAANAVSTEGYEEPKGIDGHRR
SNEMQQKEIFINLKSNSEALISSVPQQQKITNQAKKGSNFEVLKRSTSFSLSNKEKNTYI
KKKGAFICRLCRFTSGTLQTVRQHMLTHRETYKKIENQTSAEMVSKYLLPRRRKGHAEKN
MDGPQMGQVFRCPNCAFRCSEKNLLDNHEETGCMKAGEVQCTECSFVAASKVSLTRHVLY
THKKKVFFDAKWQRLRCQHCAFSCRHKGIMERHILLKHKSARHTTTKKDESLRSGIRRYC
CNMCDFSAQTPHRLRRHSHRCHSGDLPHVCTHCDAPFSSDIALRNHCQRSHSIQVSFSCK
QCDFTCARDGLLKAHQQSKHPRVKCTTCQKSFETEKSLEIHQRAHHVHQCQSCPFSSKTK
QLLADHLLSKHEEGSPESKPLKCSICPFWCRHHLVLEQHLRSHGSKRMYKCTDCQYSTRN
KQKITWHIRIHTGEKPYSCEQCTYTCADPSRLKLHMRVHQKEKKYLCPDCDYKCKWATQL
KYHMTKHTGEKPYACDQCDYRTNRADALRAHRDTQHCDARSYVCEKCGKAFKTSFILKTH
QRKHIAGRPYTCGVCQKAFRWPAGLRHHYLSHTKQQPFRCRHCSYRAKQRFQVVKHLQRH
HPEMPTEQGVVKDSEAGTLTLKEALQGTLDEKAATPVIGEEK
Download sequence
Identical sequences H2MIY4
ENSORLP00000018617 ENSORLP00000018617 8090.ENSORLP00000018617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]