SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019001 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019001
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000707
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019001   Gene: ENSORLG00000015163   Transcript: ENSORLT00000019002
Sequence length 198
Comment pep:novel chromosome:MEDAKA1:22:11116359:11118947:-1 gene:ENSORLG00000015163 transcript:ENSORLT00000019002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSFGGLSRSSTVASLDTDSNKSSGNSTSETCAE
FRVKYVGSIENLEFEMSRSLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVA
SLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAKQEECSIWVYQCSSSEQAQS
ICRVLSTSFDCALVSDKS
Download sequence
Identical sequences H2MJZ7
8090.ENSORLP00000019001 ENSORLP00000019001 ENSORLP00000019001 XP_004082307.1.28442 XP_011488631.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]