SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019259 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019259
Domain Number 1 Region: 368-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000912
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 400-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000191
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019259
Domain Number - Region: 353-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00417
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019259   Gene: ENSORLG00000015385   Transcript: ENSORLT00000019260
Sequence length 437
Comment pep:novel chromosome:MEDAKA1:14:32355587:32374055:-1 gene:ENSORLG00000015385 transcript:ENSORLT00000019260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVMAASVGLPMNPPLAAEERAVFAQLKPVRMSGADGAEDASVFEDVKPGVLSHPPPPPK
KNPPPLFSLSVFQTALELDKYLPQVASPLLTASTDANDKKYRRESASVVDEYFSEDKPST
PYSLNINLILPNTTHLRTGLYRPNTKTLTPHQIKTEPGLEVPCSMPTTTQALPDFTSVFS
MPPVVNNVYIKPENLDTELHIGPQPPQPQVYHMPITSSADLTMTLSHSSSSAHDSAGGRT
MLNLGGNNYMMAEHQLQQHHAYYQVSPSNVPQHTAPHSLPPSPPNSQPGSPDGHAELLSL
ASQPPPPYQQRLGGAKVAGLTPHALLMTHGQGVLTGPKYNRRNNPELEKRRIHFCDYPGC
TKVYTKSSHLKAHQRTHTGEKPYRCTWENCDWRFARSDELTRHYRKHTGAKPFKCVACSR
CFSRSDHLALHMKRHQN
Download sequence
Identical sequences H2MKP0
8090.ENSORLP00000019259 ENSORLP00000019259 ENSORLP00000019259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]