SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019520 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019520
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily POZ domain 9.22e-31
Family BTB/POZ domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 575-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 536-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 508-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000635
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019520   Gene: ENSORLG00000015589   Transcript: ENSORLT00000019521
Sequence length 698
Comment pep:novel chromosome:MEDAKA1:4:28554646:28557400:-1 gene:ENSORLG00000015589 transcript:ENSORLT00000019521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAADSCIQFTRHASDVLLNLNRLRSRDILTDVTILVNRQQFRAHKTVLMACSGLFYTI
FTDSHKCNLNAISLDPKVDPEGFAILLEFMYTSRLTLKESLIMAIMNTAIYLQMDHVVDT
CHRFIKSSDPAAKLPRDEFLISPLVLPQDVHAYRPHDVVDSLHGRMAPFRDGRPYGANMF
GGVSTPTNYHLYGQFPMPGFPFPLCKLTDTKNTFADLSKAGIHHKNCSPHDSTSSIRADY
SRAFGTSIIHSTTYASREIGRDDDIRKESHEGVAHSVGLSSRKRAFPVLNLEHQKDSGKE
HAPRADEDLLHQHYPLGISSAGRKSLVSSPQSPLKSDCQPNSPTESSSSKNAGLSHAGGV
QPPQGTPDPKARNWKKYKFIVLNQSARESEVGLRDPGLHSPQRLGLQPYHHPSDSENLDP
QSRSKSSGHSEDLPTPQASRLNNIINGSLEGSVRGADPPHYLNRLSCSTCGSQSPQHSEV
CPHASRTRLSEDMSELHSEYSDSSCENGTFFCNECDSKFAEDEALKQHMLQVHSDKPYKC
DRCQAAFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCG
ARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFR
HKSQLRLHLRQKHGAITNTKIQYRMSTADVPTDLSKAC
Download sequence
Identical sequences H2MLE3
ENSORLP00000019520 ENSORLP00000019520 8090.ENSORLP00000019520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]