SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019595 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019595
Domain Number 1 Region: 187-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 305-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 1-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000226
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 243-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000546
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 150-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000376
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 342-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000858
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 95-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000431
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019595
Domain Number - Region: 63-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00686
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019595   Gene: ENSORLG00000015650   Transcript: ENSORLT00000019596
Sequence length 403
Comment pep:novel chromosome:MEDAKA1:23:17388653:17389880:-1 gene:ENSORLG00000015650 transcript:ENSORLT00000019596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRGRKALTCETCGKTFTRTSDVRRHQLTHTGERPFHCSQCSRTFQHSWDLAKHKSKHHGL
TISFSCQLCGSSFPNLRALTVHHKKSHAQESQLPRMCSICSQSFPTSTELLKHRKTHVAT
KRYICQKCNEGFDSLLARSQHRQLHRFKRQLCPHCDKIYTRRSDVKRHLSTHSGERPFQC
NQCSRRFSLRFMLTKHLRVHTGERPFQCSHCPKRFTLASVLARHERMHTGEKPFLCSQCG
KGFLSQGELSKHHRSHVDDRPYSCTQCNKRLKSKKTQQEHILSHTGARPYPCSYCGKGFT
KPYALTLTRHNLIHTGERPFPCGHCEKAFLTVSEAQLHRRIHTGERPYPCDACELKFKSS
SELARHKRCHSGFKTPKLFCRQCKKSFTSTATLKKHLETHSGE
Download sequence
Identical sequences H2MLL6
ENSORLP00000019595 ENSORLP00000019595 8090.ENSORLP00000019595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]