SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019627 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019627
Domain Number 1 Region: 448-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.29e-46
Family Eukaryotic proteases 0.000016
Further Details:      
 
Domain Number 2 Region: 148-174,203-421
Classification Level Classification E-value
Superfamily vWA-like 2.7e-43
Family Integrin A (or I) domain 0.0000214
Further Details:      
 
Domain Number 3 Region: 110-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 4 Region: 44-105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000054
Family Complement control module/SCR domain 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019627
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000181
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019627   Gene: ENSORLG00000015672   Transcript: ENSORLT00000019628
Sequence length 728
Comment pep:known chromosome:MEDAKA1:13:32688154:32694751:-1 gene:ENSORLG00000015672 transcript:ENSORLT00000019628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLLTYHCGPGQYPSPVSSRLCEDDGEWTPMRLATGRLTSSATCKNILCPGQLQLDNGDF
WPRNQWFRVGATQSFTCQDGFRLHGSPERNCTVSGDWTGSSPVCDKHEDDCDDPGIPPGA
ERSGGQFDIGDKVTYQCQAGLNLLGSSERVCMEQREWSGSTPRCQGPNTFDSPSYVAAAM
AGSLAGVMDVVSPDFKKQSRSQQGSKLRTIRVGDVSRMHIYILLDTSGSIKKKDFNLSRE
ATIALIKKLDSYDIQLNFHIVSFASEAQVIVDIKETYTSSNADEVISSLTEFDYHSHGQK
TGTNLYSALQAVRERISFFKENKGSAFNETQNIIIIETDGYSNTGTKPQIALAQIRELLG
YGNSLQDHTSVFSDVYAFGVGDQVNKEELNSLASKKSGEQHAFVLKGYDTLGEVFNSIIS
ETSGDESVTMCGIAQEEISQKSQEDCIKAYTRPWHVTLTSPEWGLQKYCSGSIVSQRWVL
TAAHCFNRYFGGYIPKQITIEAVTGGEKLNAEEVKIHPNYNTNALKHRNVSEFYDYDVAL
VLTTAAIRLSWAARPICLPCTIAASRALKRINSTCEEHRQELLAHKETTAFFIHKKTERK
QTHIHIDGQRPACVEKARQTLKEPTNVTLDEYVPDRFLCSGGTEGYQDAITCKGDSGGSL
FLQKRKRYFQVGLVSWGTTDICDRNNRAHGSNRPPPDARDFHIDLFKIMPWLKEHTGKEI
KFLPEFDP
Download sequence
Identical sequences H2MLP7
8090.ENSORLP00000019627 ENSORLP00000019627 ENSORLP00000019627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]