SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019631 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019631
Domain Number 1 Region: 191-304
Classification Level Classification E-value
Superfamily POZ domain 6.8e-26
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 671-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000139
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 905-957
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000459
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 768-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000951
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 813-865
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000264
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 582-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000752
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 7 Region: 726-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000342
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019631
Domain Number - Region: 884-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000193
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019631   Gene: ENSORLG00000015676   Transcript: ENSORLT00000019632
Sequence length 1086
Comment pep:novel chromosome:MEDAKA1:4:29560547:29566964:-1 gene:ENSORLG00000015676 transcript:ENSORLT00000019632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCEESYLAIRRYLTDEREPYAPGTPGNTKRKIRKAAACYVVRNGTLFYQRRLKGQNDFT
ELEVVLQDSRRKELIKDAHTMAEGEHFNQQLTWEIISQKYWWRGILKNVKDHIRECAHCQ
SKRSMDDGSGSRSFSRTGKRRHDEEPEEEEEEDDGFFVKDVSSQQKSRAPKEKGRHEVVF
VDSRGEVNQFLPKHSQTMLDKLNRQRLENQFCDITLLIEGDEYRAHKAVLAACSEYFNEL
FFEKGAVTTHEAVVDLSGFAKASFLPLLDFAYTSKLTFNFCIMADIANLARHLLMTEVLQ
ICESVHKQVEDHKLTVYQKGEVHTVVSSQPAPQEEGEAVHTEEVAPMEPVALIAHSAHVE
EAETVTLITGSADGMEGEAMTVVTHSGQAGASESLAVVSACLAMEQPQVAEEETYVISVD
LEEANSSEGAKKTVSSQQQGEQQQEKQQEETVVMQKAEAEVEVEAVVVPPKRKRGRPAKV
KKVVEMEDMVPAEEVPSPDEGSSDKQESLSDDPRRRRLRQRSMAEGGYARLHMGLEEEEE
KGSTLPRVTPPKVGPRHGKRGRPPKQPVQLQAASEGAVDGEHTCSECGMSFQRRYSLIMH
TLKHEKARGYKCSLCSKEFQYSASLQAHLARHKQHRSQWGAPAKVPAEHGSQGREDAEAN
DKTSASATKREFVCDICGKTLPKLYSLRIHMLSHTGVRPHSCKVCGKTFAHKPSLKMHRA
LHDSAKQFQCEFCSKTFMSKRSMEEHTSLHTVKSTGESKYLCNTCGTTFYRASALSKHLK
RHQPRPEVRPFSCSHCDKSFYESKDLQQHMNKHMGLKPFQCQVCGKCYSWKKDWYSHVKS
HSVAEPYKCNVCGKEFFEKALFRRHVKKATHGKKGRVKQNLERECEHCGRKFTQLREYRR
HVNNHQGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPLCQEAHIDARTLRKHMAK
YHVDNLPGKIMLEKDTLQFHNQGTQVEHAVSILASDLPPELRPAQQAASEEIETVLITEE
TVEAVEAVQAVQGASDGSMSTLSDQGIMQVVNYVLAQQGLTEVKPDEAPEVIQTMEVEVA
HVTEVE
Download sequence
Identical sequences H2MLQ1
ENSORLP00000019631 ENSORLP00000019631 8090.ENSORLP00000019631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]