SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019708 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019708
Domain Number 1 Region: 99-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-82
Family Eukaryotic proteases 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019708   Gene: ENSORLG00000015737   Transcript: ENSORLT00000019709
Sequence length 480
Comment pep:novel chromosome:MEDAKA1:17:23738439:23741566:-1 gene:ENSORLG00000015737 transcript:ENSORLT00000019709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFASFSCATVSPSSASSEPSCDVISKAQKLQAEAERSWALSQVCAYYQHRCPPTEVNTES
CIRIMGESCSARVLQCSLLNTMQNLEPATQTQAQGERTMQMLTDYLKMLYLICITSSLAA
ACGRKLSSVQNITQPRSRIVGGSPAPPGSWPWLVNLQLDGALMCGGVLVDSSWVVTAAHC
FAGSRGESSWTAVVGEFDITKTDPDEQVLKVNRIISHPKFNPKTFNNDLALVELTSPVIL
SEHVTPVCLPSAMDPPTGTPCLVAGWGSLYEDGPSADVVMEAKIPLLPQNTCKSALGKEL
VTSTMFCAGYLSGGIDSCQGDSGGPLIYQDLISGRFQLYGITSWGDGCGEKESVGSREPT
CPDLLKTTDMTEEEQRSEFGSLCRFYTLTCPPGQSVSSCTQLAEEKCLNRFKKCQLRSFL
QSLLDLLQRAEDYIRDRVDLTFFTQTLPQLVEHIYNTAFTPSREKRDLRVIPSLTQIKGT
Download sequence
Identical sequences H2MLX2
8090.ENSORLP00000019708 ENSORLP00000019708 ENSORLP00000019708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]