SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020165 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020165
Domain Number 1 Region: 203-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 148-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000101
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 241-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000131
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 4 Region: 330-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000089
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 358-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000949
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 424-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000977
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020165
Domain Number - Region: 27-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000754
Family C2HC finger 0.072
Further Details:      
 
Domain Number - Region: 275-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00109
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020165   Gene: ENSORLG00000016115   Transcript: ENSORLT00000020166
Sequence length 625
Comment pep:novel chromosome:MEDAKA1:7:25137982:25141967:1 gene:ENSORLG00000016115 transcript:ENSORLT00000020166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKLAPDAPRFPLSAPADAGQCLVMEASPDIHICGFCKQQFNNFEAFLAHKQGGCSPPAPE
PAGEAPPRFCSVSLPAGAAFTPPFSVCSQIPADFVLEDTPQSCVRRGTKKILSKAQKAPA
RKLKPAAASKRHSCCFSGCTFKTQYGQKHMERHLKTHTGEKPFECELCHKRFSRRDKLNM
HSRSHTGERPHKCKLCPYAAADSSSLKKHLRIHYDERPFKCQICPYASRNSSQLTVHLRS
HTGDAPFQCQQCDAKFKINSDLKRHVRIHSGEKPFKCDFCEYRCTMKGNLKSHVQIRHSS
EDSLQCALCDFKCAGKAVLRQHSRQHRPAQPLQCSKCTYSCSSKGALKVHERIHSEDRPF
KCHFCGFSSKQLSNLAIHKKKCHSEAPDNGGGGGKTASRSGVKGTAADPPKPVSSRYRAK
LEAARAYCCDLCDASFVREDSLRSHKKQHRDNQSTPLAADPASLLPVAVPHDTQLPIQTG
VVAPFTNAQLKILVAPQDASIPAAVDAQNKPGMVLLSPENQDMVLNSVIHQVNLLTPLQS
LGSPQTAGEPHTVLLTHLSPEDSSNPLHQALLQTAISPHDPNGAQTFITACPELDGLSSL
IQGGGTEVTVVTEGSSALVTAAALP
Download sequence
Identical sequences H2MN65
ENSORLP00000020165 ENSORLP00000020165 8090.ENSORLP00000020165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]