SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020343 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020343
Domain Number 1 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-19
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000259
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 320-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000467
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 568-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000295
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 243-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000486
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 166-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000346
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020343
Domain Number - Region: 4-126
Classification Level Classification E-value
Superfamily SET domain 0.000458
Family Viral histone H3 Lysine 27 Methyltransferase 0.08
Further Details:      
 
Domain Number - Region: 296-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0333
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020343   Gene: ENSORLG00000016247   Transcript: ENSORLT00000020344
Sequence length 631
Comment pep:novel chromosome:MEDAKA1:4:30588936:30649810:1 gene:ENSORLG00000016247 transcript:ENSORLT00000020344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMYVPDRFSLKSSKVQDGIGLYTARRVKKGEKFGPFAGEKKLPGELDESSDTRLMWEV
RGGKGDVLYILDASNPRHANWLRFVHQAPSQEQKNLAAIQDGENIFYLAVDDIETDTELL
VGYLDSDMEEDEDEEEDDIKDEDENSKESRHLVEMGTAELVIKKEDHPCLLCESSFPSEE
ILAAHLQSLHQRPSTEEKEFKCRNCGKKFPIKQALQRHVLHCSESLDPSGDSKAHQCSFC
HNSFNSESSFEQHKEACKGDARFICKAESCGKRFKSKDALKKHKGNVHTGSGRRKLICTI
CNRKCSSSLNLQEHRKIHEIFECHACDKKFISTNQLKRHMITHSEKRPFTCEICSRSFKR
LDQVTAHKIIHSEDKPYKCKLCGKEFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSL
QRHLLIHNSERTFKCDQCDATFKRKDTLNVHIQVVHDGHKKYKCDLCEKAFVTPSVLKSH
KKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCPYCDKAFSKNDGLKMHIRTH
TREKPYKCSECNKAFSQKRGLDEHMRTHTGEKPFQCDVCDLSFSLKKMLSRHKLTHNPNR
PMAECQLCHKKFTRNDYLKVHMENVHGETES
Download sequence
Identical sequences H2MNN7
ENSORLP00000020343 ENSORLP00000020343 8090.ENSORLP00000020343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]