SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020436 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020436
Domain Number 1 Region: 40-184
Classification Level Classification E-value
Superfamily PH domain-like 5.54e-43
Family Phosphotyrosine-binding domain (PTB) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020436   Gene: ENSORLG00000016324   Transcript: ENSORLT00000020437
Sequence length 198
Comment pep:novel chromosome:MEDAKA1:24:13706633:13730306:1 gene:ENSORLG00000016324 transcript:ENSORLT00000020437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLADARSRLVMDALKSAGRAIIKSPGVPRHTWGTSKHEKLPENWTDTKETLLEGMVFNV
KYLGMTLVGQPKGEDMASAAIRRIVATARASTKKFRKVTLTVSPKGIIITDTETTDLIED
VSIYRISYCTADKTQDKVFAYVSQSQFNETLECHAFLCQKRKIAQAVTLTVAQAFKVALD
LWEIAQEILGKKSRTCCS
Download sequence
Identical sequences H2MNX8
ENSORLP00000020436 8090.ENSORLP00000020436 ENSORLP00000020436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]