SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020572 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020572
Domain Number 1 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 527-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000149
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000945
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 83-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000285
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 610-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000422
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 162-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000364
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 19-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000743
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 9 Region: 305-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000548
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 10 Region: 221-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000125
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 11 Region: 361-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000221
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020572   Gene: ENSORLG00000016432   Transcript: ENSORLT00000020573
Sequence length 663
Comment pep:novel chromosome:MEDAKA1:23:20428763:20430925:1 gene:ENSORLG00000016432 transcript:ENSORLT00000020573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESEESAAAKKQRKKYSKNKTCPVCSKSFLRAAAMRRHQETHNSNRDLKYKCSSCDKRFRD
QYDMNRHAMRVHENTSEVAETKTCSLCGKYFARQVDMERHMKSHSEERPYKCSFCEKKFK
NPYVLKRHEKEICKSREHRRAKRKEPASANPPPSAEVTEQKVCPICSRVLPCTADMGKHL
RSHSEERPFICVTCEKGFKYKDTLKKHQIIHGHEGIREEQICLRTFDSVKTLNRHVQCHT
DDRPYHCIHCNKHFKHMHGLKRHQIYAVCHKKSSRFFWKKGLRVGSGQGDASGSNPQQGA
QPRIPVWCSNCGKHFEYPSALREHQENVCKLELRDVMKCSDCDKEFKSVTMLKVHQRIHD
PLYCKECGKILANESAFERHKLMHRPMQCTMCEKTFTLLRRLREHYSKQHGFSGPFPCSQ
CNKTFVQLSYLAIHQRIHKGEFPYVCDMCPEKFRSSNCLTVHQRKHTGEKPFLCWQCGKC
YRSASELTVHMGTHSEERPWACTQCDMAYRTKLQLTNHVEQVHIGVRYPCNACGKQFMKE
TSLKRHELIHTGERPHQCTVCGKTFLTANELRLHNRYHTGERPYKCDVCSKAFIQSGYLK
AHMRIHTGEKPFKCDICDKGFRLSNHMKKHRRTHAGKQKSFVCEECGLVFLDKKALWEHS
LSH
Download sequence
Identical sequences H2MPB4
ENSORLP00000020572 8090.ENSORLP00000020572 ENSORLP00000020572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]