SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020663 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020663
Domain Number 1 Region: 352-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-41
Family SPRY domain 0.0031
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-19
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 138-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000366
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020663   Gene: ENSORLG00000016506   Transcript: ENSORLT00000020664
Sequence length 530
Comment pep:novel chromosome:MEDAKA1:6:26487415:26493783:1 gene:ENSORLG00000016506 transcript:ENSORLT00000020664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSSDLLDCSICLQLLEEPVTTICGHSFCRQCIERFWSSKAEGSSSCPQCRRTFRSRPA
LQKNIVLVGLVEDYRRRTAAADEDDDGYAGPGEVQCDICKGRRKKADMYCLVCLAFYCQT
HLQPHLDVAPLKKHSLVQASTKVKEHICRRHDRRLEMFCRSDQQLLCPLCVLTHKAHDIV
EIKEEMVAKQRQVRRSQQETENRLTESVGEMKELKKAADSISDAAWEACDDFERQCGEHI
RWYSHYLDEKCTEMREKVGQLEKAGLDRTRSRRGQLERAVNRLKGLQHELSQLSQTDDPV
QFFQGFQALSDLLEFKGSEEKPDSSQELVSECKEKLKIMCTKEKALLFHQSAQKEYADLE
LDLNTAPACLSISKTKKSVFWGDDNQVDSDHPDRFTYFYQVLCQRGLRETSYWEVSWDGG
IVEVAVSYIGIQRKGSGGLCCFGHNKLSWKLTCSHSGCTFWHNKLHRSGIPPAACNRVGV
HLEYEEGRLTFYSILDPETMVLLHQTQTVFTEPVYPAFSVDLGAKLKICN
Download sequence
Identical sequences H2MPK1
ENSORLP00000020663 ENSORLP00000020663 8090.ENSORLP00000020663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]