SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020764 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020764
Domain Number 1 Region: 842-930
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-19
Family DBL homology domain (DH-domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 1076-1135
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000129
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020764   Gene: ENSORLG00000016585   Transcript: ENSORLT00000020765
Sequence length 1268
Comment pep:novel chromosome:MEDAKA1:5:30549861:30565162:-1 gene:ENSORLG00000016585 transcript:ENSORLT00000020765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDYVDLVDISNGKQPVEKRRDSCEIQNKLVSLQPVRPPPPIPLGQRASCRHAPQHAED
PCNPCSQMQPGLELFHPDLKCRYRESYLEALSNPVAFERGDADLLSALEEVHLCEVGDGK
PRGTPEAPEEHLENICNGCENPVMWSDSCQCNPKNCCEQTSENLDCHPLSIPEPEVPLNE
TASNLSVQTQQAPQQFGSTAAVHPAPDVTSVTCDVKGEPPTSKPNRLLNSAMTSRVCSGA
LHPSRDPAEVKLHPLQMSFLQQTQALSRTSKPQNLLSAGSAACWNWELFIYQVIACTGSR
DRNGRAVVEVHGDREEWMSPLVSAQSVCELLLYLHAIPRKDVRQLGMTLIINARKKPPPL
HLYKALLMAQEQALHPVHCIIVLMDKDTCPRPEKHPGLQMDLVTSLRALNKTVEASQVTS
DLGGTFTYSHTDWLQFHRSSNKTLLNVLHFCILRSVQELSQTLSLQEEVQQSIQEQKILM
KNVLEDARLVTLQREGGALLARMKNFHSLKITESATSLYNQVEEKLHTLVMRSNESLQHL
EVLLKIRETEAEVITAGMWFSTEGEQSLKDFCTTDDTDVKKTFQDFSLFFALSKEKQQHA
LTYVREAEEITGTSNSCPAADILRTLVSTFKSNMEDFMLRAERRQKELNSMVQQISCRNI
GEGCWTTQTLSTLQLYKERLGGEFSDSNFQALRAKACTVGPGASGMMKTWNAARVRCQEV
KQRLEEVQRKKRGKDKNQIPQTAAVNPPGKEKGKRRPRDHHSESDLRTTKGPKGLLLHHN
LGRSLSEGSRATSASSFLPAVIRHKHCHSRTQSLDENMPTIHTLHQDSLSPPQKVFISCH
RHRRARRILEELLSTEREYVKALGYVREHYFPELERPDVPQDLRGQRGSVFGNLEKLHDF
HHHHFLEELEGCLSEPLRVGRCFLRHVRLLNIIHQLIFSLFEVQADITSSSLLSFGLVEG
ELCFVCPLQQEQAAVRQSPHQSRTQFLQDSTRDKQEVSQCDTNEQRLNVRKAPGPDRMSP
RLLKTCANELGSPLKHLFNLNLNVPSLWKTSCIVPLPKVKHPEEKNKPKKKTFFFNQTSD
IGMTQNSGDSGLCFEIWFRKRKSEDTYTLQAASREVKEAWTRELEQILWEQAIHNREVRM
QERVFLGIGNKPFIDIQPSEAAIHDRAINYALMGRENKVLLPCGSKVQPSGARPKSIGYG
SSSASSSSSGRGSLSPEGYVRLPKRRVVSDGGYASPPGSLEEDDLDQESDSHNLLLDSSD
SSGESVCG
Download sequence
Identical sequences H2MPV1
ENSORLP00000020764 8090.ENSORLP00000020764 ENSORLP00000020764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]