SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020984 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020984
Domain Number 1 Region: 4652-4811
Classification Level Classification E-value
Superfamily SET domain 9.55e-35
Family Histone lysine methyltransferases 0.01
Further Details:      
 
Domain Number 2 Region: 1031-1092
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000171
Family PHD domain 0.0047
Further Details:      
 
Domain Number 3 Region: 402-460
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000576
Family PHD domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1105-1174
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000775
Family PHD domain 0.019
Further Details:      
 
Domain Number 5 Region: 982-1039
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000642
Family PHD domain 0.015
Further Details:      
 
Domain Number 6 Region: 352-406
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000244
Family PHD domain 0.012
Further Details:      
 
Domain Number 7 Region: 1705-1752
Classification Level Classification E-value
Superfamily HMG-box 0.0000127
Family HMG-box 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020984
Domain Number - Region: 482-536
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00093
Family PHD domain 0.023
Further Details:      
 
Domain Number - Region: 285-331
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0598
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020984   Gene: ENSORLG00000016772   Transcript: ENSORLT00000020985
Sequence length 4811
Comment pep:known chromosome:MEDAKA1:17:26049077:26109849:1 gene:ENSORLG00000016772 transcript:ENSORLT00000020985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSSEDKSVEPSDQLPSPLPSSVGATSTGSPVHTDKRPRGRPRKDAVAILAQTPPPSTSK
NKKKGRTRGKVAVEEEDSMDGTEITESTDPPDTETQTQQAETMEVLTADLPDEDKPFSPL
AFSPSVESSDGPTVPPSGGIKSSFSERLCAFCYCGGHSLLGQGDLKVFNTTFQDEKFLRC
RGEGGSTNDNGDGDTTTQPQLAEDIASGQKKANPPQKETISYGAVSCKAEPDLASRFWDE
LSYVGLPKDLEVQSLFESEISGKCWAHESCALWSDGVCKSEGQSLLNVDRAIDSGSTKHC
AYCKRLGASIKCCAEGCAQLYHYPCAGAAGTFQDIRSLSLLCPDHIEVAIHKFVDDVNCV
LCDSPGDLLDQLFCTSCGLHYHGMCLDMAVTPLRRAGWQCPECKVCQTCKNHGDDTKMLV
CDMCDKGYHTFCLQPAMESLPTNGWRCKNCRVCIQCGTRTSGHWHHNSLLCENCFQNQDP
ALCCSMCSCILDPEHHKDLLFCQTCKRWLHLECERQNSGQTEINPREDYVCFNCRSPAAE
QALLTEDMDLGPELRLQPASMHTDSETGLQLAEKHTDPETGNQLPPEMHNDPKPELVTVS
LHSDPKPVQATVQKEELPVTDQKPDNINEMINSVSKMDTHIINQTKTKLGPKNQASHGTD
SVQTQDTEPSVKEIPVGSPPESKPAVGIQLLSEESPVASSNQSQEPLPVQQPAEATEAQD
TLLQIKPAHTEACPFEGMANHSTKDFKAIISPTKEQSTTPVTYVDQPMEVTLLPQPSSVN
LTGASFLETAPTEEKPIKSSVERLVEMVSSSHSSPLTRMAPLKEAPQTHILPSLDDGSGV
IPPTALVPFTPKIGMGKPAITKRKFSPGRPRVKQGAWSPHSSVSSPLSWSSDQPEGWDPK
TRQPSYSPGWSIRVGRGSGFPGRRRPRGAGLSGRAGRGRARGKNGVSSSINPGLTTFEMQ
YPVKEEEENAMHNTVVIFSSNDSFTLKQDMCVVCGSFGLGAEGRLLACAQCGQCYHPFCV
GIKINKVVLSKGWRCLECTVCEACGQATDPGRLLLCDDCDISYHTYCLDPPLQNVPKDSW
KCKWCVSCTQCGATTPGLRCEWQSNYTQCAPCASLSTCPICLVNYSEGTVIVQCRQCDRW
FHASCQGLHSEDDLEKAAENSFDCTICQTLKTTKVVTKTRDSNAPLVLTPYVTKARELDL
SRTYTQDGVCLTESGLCQLQSLSAAASRRRKTKPKLKLKIINQNSVSVLQPPMDSLSELS
RDEDMEDNREAELLDCEAKSDSSLEREPMEDDSKGVDGGKKRKRKPYRPGIGGFMVRQRS
RPGQGPGKAKRSYCRKDSSGSMSENLIGKDEGWAELHPDTPVDEVAPGPEVPEKIKKRYR
KKKTKLEEAFPAYLQEAFFGKDLLDKSKQSRQHGGESGLLEDGQNQVERRRTNTSVLDSS
SVLNFSATSIPTRPGIAQTPDEPLVDLADVLNSDADILGMLGKSSSESVPTAGLDIGPLT
DSSTVGSQTGRRTPRTIADEPLDGILSPELDKMVTDETILSKLNKIPELEGKDVEDLFTA
VLSPSTSQPLTTQMPHPQIPGALPPTACSSMSHPNTAFPRMPMINGMMGPNQRFPANPGT
GPRFPENVSSLNRMPFSENPRDRKFNQMPREAVGPWPPSAHGSAPALPGSLPEGETEAMS
NAQRSTLKWEKEETLGELATVAPVLYTNINFPNLKEEYPDWSTRVKQIAKLWRKASSQDR
APYVQKARDNRAALRINKVQMSNETVKRHHPQQQPPEVFDPNIPLDTELLFKDPLKPKES
EHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNQSDGDGSNQSPASQPSNESMSPMQQFN
SKENFVRPHLQGTPSSAPLEDVFIRPQPPPPSGPSSQPQSPQVFSPGSSGSRPSSPWDPY
AKMVGTPRPPTLGPNACRRIPVESSKSPTPLIEQQDKGRPSPAHESFGSPTSASSDPYAK
PPDTPRPSGEVDLFLKPMGPPRNIQSAHGRPPMGSPGRDPYSRPMIRNDAYQRMTQNRMI
LSDPYSRPLIAPIPGSNESGSVPLFKTPMPPPQTQDLFNRPGPHSNDRFLQNQQSDPYAQ
PPHTPRPLGNDGFTNPSRMGQHHLQGHSFHQPGPMNQTSRNPYAHAPSTPRPDHFTYDHY
PQPPGPNKQGSDSFSQPTVNQRAINEHGTQPRPFFEPYARPPGTPRPHDNYVQPSNAFSQ
SSDPYLQAPGTPRPSSQRGMAEPFPSTCVPLRAGIGEAFPQPGAPRPMLNDPYAQPPGTP
RPGPDGLNRPVLKIGPLASQDPFSSPQGRLQEHFSHSDSHAPKHSNVPEDGFSQSPSRRP
NQTPSHDPFDQAPMTPHSQSAENIEAKDQAAVSISGTGPQDPVQLFNNPQVSGTSADAQG
LAAVETEERLKQRQKIRELIKQHQQKRQERSLQEPASMAPGTPRPWPQEGPSQQGEVFNR
PPPPYPGQVPIRGPTRFPGAFQGDRVPFHNEGQLPCAPNPGDSNLRHQGPRFAFPAGLLG
PHGAQGFFPRGQHPMQDVPPQIRQSMSAEMTRGMGGNPMGLPQHFPPHNMPMQQHNIMGQ
HFIELRHRTVENRPRAPFPLGAMQGNNLDPNVQGQRSAGFPGAHDSRFHLNHGLKMLDPN
QTGHLQPSASMENLHHQTQSSGINPMKQSPLMRSMSQPASNEAHNFAPSMMFPAASAGPI
ENVSVNNSEAVEEKLDTDDSAVKDLEDVEVKDLVDADLENLNLDPEDSKDLDLETNDLHL
DDFLTSGKFDIIAYTDPDSDDIKKDMFNEELDLGDPIDDAAESTNTNKIISTESGKSIAT
VAKSECASKQSTEEPKPEVSGNRDSDSLPPDQVVKSEVKDCQRPTKVVHQQASENATHQQ
GVLSDSTPVLSSLLIKQQPEEQSLNTISASVSQGANLMVQQNQVTDTRQTSEHALSQTIP
DTTVGEVSVTGFGVEQQMGLSPGVDQSGLSQTQQGGGQLGQQQRPLLLEEQPLLLQDLLD
QERQEQQQQRQMQAMIRQRSSDSFFPKIDFETITDPIMKAKMVAIKGINKVMVQNNMGMT
PMVMNRYPPGPGPPCPESTPLPPQVLGPDGKLTQVTRPNPPTFGPGFVNNPQRAQYEEWL
QETQQLLQMQQKFLEEKIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQGVV
QKHLEQIRKQQKEHAELIEEYRVKQQQNNMTPIMSGMHPLPGSAGMVPAGPPMVQPPINP
MMQMPLRSGQPNAPPRMPNPQPGWHPGAPMPMSGPGMPPLMPPQPLQMPMAQMPMDPQAP
HAPPGGAKPLQAGGVKFDDNNPFSEGFQERERRERLREQQERQRVQLMQEVERQRALKHR
MEMEQQGMMGPDGNMAPLAQMPFFNSELPQDFMQPQRPSMPQSHQLGPMFPQQQGMQHGI
SSPPGTFIQGDRRGMMGNGMMAADVGPDNVPLQGLGFPHGHPRPRQFSGPGLMPAEGPPF
DGDTATPLPSNFPGSGQSLIQLYSNIIPDEKGKKKRNRKKKKEDDADSVKTPSTPHSDLT
APLTPCVSDTSSTPTRNTHLFGEQDLSRSPLLGSSTPSHTELEKQLSAAQSGPHGLPSET
SRTQVQDHDRILSNIKLEKTETTECHGQREGSICSDMSSVKEEGNKGGVSPFPAEQSPNK
GESSNELLKHLLKNKSTPPPALSHQRSEESLRSEEGETPDCKSFLRQSSMDSSGAYSDGT
SDFPGPQLPEQEKKKGRNKRPPKGGEKPASRYKKRKKDRDERQLMHSGSDTVITQIKQQS
NLSNPPTPPASLPPTPPPVSRQKMINGFATTEELASKAAAMVILNAVSKGLVPKPLHVPF
RPEEDLLARAIAQGPKTVDVPASLPTPPHNNQEELSNRGQEACKDRDTPDSFVPSSSPES
VVGMEISRYPDLRLVKEEPLSPCLSPAFPLLPAPDGKGSEIKLQDIKTEPSFMFFGSPLG
PVSSDSKQGLVSVAITLRPAAAENITGVVAAISDLLCVKIPSSYEVSSTPDRAPLSMLNA
QRMGPLGMEARHPMLFHGHGDGGGLQGRHGQMIRAGGPQGVMQQQGHQFRFYQNNQAQDA
RIRLLRPKKLLHXKVVVLGSGVQKAIRDLPDHMKEPQMGLNSEEDLVFCSHSCFVLYCSS
SLSQSRPMAAETKESMSLLPSSDQSENLCKAHHQYNNNMSSLDVHCLAKLQPKHSPPSTP
PIPFPAADEAPKSEIKSDALKVTVKLKARPRSHDGWHQGKRQKGLRWRKWTVQVVVPRGN
SHLPDEDKIDELLKKLGASLRPPASLKDQRRCCFCHQFGDGITDGPARLLNLDLDVWVHL
NCALWSTEVYETQAGALINVELALRRGQTIRCAYCQQIGATSGCHRPRCTNIYHFTCALQ
AQCTFFKDKTMLCHAHRPRGTGGQALEHELRCFAVFRRVYVQRDEMRQIATAVQQPELGF
TFRVGSLVLHAIGQLTPLQMASFHSSTAIFPVGYEACRVYWSMRHGNRRCRYVCSVEDND
GLPEFTIRVIERGYPDLLLTDASPKGVWDKVLGPVAEKRSESGTLQLFPVYLKGEDLFGL
TVPAVTKITESLPGVESCDRYSFRYGRNPRLVLPLVFNPAGCARAQPRTSSPYTSLFLLR
PQPQAASSSSARSNQNVAQGEGGVPHSKTPVVHPRSSQYRWMKSEWRANVYLGRSQIQGL
GLFAARDIEKQSMVIEYNGTILRNEVAIRKEKVYRSQNRAVFMFRIDSEHVVDATRTGGL
ARYINHSCAPNCVAEVVTFERGYKIIISCVRRVEKGEEKIVLCVKEEYTTNQGRHRIACH
WGAPKCRKWVN
Download sequence
Identical sequences H2MQG5
ENSORLP00000020984 ENSORLP00000020984 8090.ENSORLP00000020984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]