SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021850 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021850
Domain Number 1 Region: 176-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 148-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000597
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number 3 Region: 218-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000666
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 118-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000668
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021850   Gene: ENSORLG00000017475   Transcript: ENSORLT00000021851
Sequence length 260
Comment pep:novel chromosome:MEDAKA1:17:28188045:28189293:-1 gene:ENSORLG00000017475 transcript:ENSORLT00000021851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHINSAKKPNYSELESPTVFITPHFYKGLPLSVIPQPEILSPAAYSPVTVWT
TSSLPLPPVPSDFSPISGYPSSLSDTSSKDHSGSESPRSDEDEQMLPKLTDPHGVEAEKF
QCSLCSKSYSTYSGLLKHKQLHCDAQTRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCK
ICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSK
TFSRMSLLHKHEESGCCVAH
Download sequence
Identical sequences H2MSV7
ENSORLP00000021850 8090.ENSORLP00000021850 XP_004079439.1.28442 ENSORLP00000021850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]