SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022211 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022211
Domain Number 1 Region: 367-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-52
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-19
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 145-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000133
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022211
Domain Number - Region: 193-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0214
Family FCH domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022211   Gene: ENSORLG00000017746   Transcript: ENSORLT00000022212
Sequence length 532
Comment pep:novel chromosome:MEDAKA1:17:30120298:30132455:1 gene:ENSORLG00000017746 transcript:ENSORLT00000022212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGVILDLDHFNCSVCLDVLKSPVTIPCGHSYCHNCIQNYWDQDDYLGVFACPQCRQT
FNPRPALARSTMLADVVEKFKETRVRETSPPAAERGLAGADDVECDVCAVRKNRAVKSCL
VCLASYCDAHVQPHYESAAFKKHRLVSASKHLRETICPVHDKLLEVYCRTDRRCICYLCL
TDEHKGHDTALADAEIQQIQRELDDMKQSSHMRIQQREKAVQELKEAILSLTHSTDAVED
ESERIFSKLVQSIEKHRADVKELLRFQEKAVIGHAEEMLENIQREMSELRRTNGELERLC
HTEDHLLFLQNCRTLHFPTNTVEMPNTDALTYVMYKSMRGTLVDVQTSLEGTLHKEVTRI
SDKDITHILPHYHDLTLDMNTANSYLSLSDGRRSVTTRAEPQPYPDHPDRFTRWAQVLCR
AGMAGRCYWEVEWAGKGGVSIGVCYKNMSRSGDGSECKLGHNSRSWTLDCSGTACSFTHN
KESVAVSAPCGRRIGVFLDFRGGALSFYNVSESMVLLHKEKVTLTQPVYPGF
Download sequence
Identical sequences H2MTV2
ENSORLP00000022211 8090.ENSORLP00000022211 ENSORLP00000022211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]