SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022410 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022410
Domain Number 1 Region: 294-425
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-40
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 2 Region: 733-864
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-33
Family C-type lectin domain 0.00061
Further Details:      
 
Domain Number 3 Region: 582-733
Classification Level Classification E-value
Superfamily C-type lectin-like 3.65e-31
Family C-type lectin domain 0.0000574
Further Details:      
 
Domain Number 4 Region: 1026-1155
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 1165-1293
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 437-572
Classification Level Classification E-value
Superfamily C-type lectin-like 6.01e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 878-1013
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-29
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 8 Region: 157-283
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 3-96
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000257
Family Cysteine rich domain 0.0016
Further Details:      
 
Domain Number 10 Region: 98-153
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000571
Family Fibronectin type II module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022410   Gene: ENSORLG00000017901   Transcript: ENSORLT00000022411
Sequence length 1399
Comment pep:known chromosome:MEDAKA1:17:31053079:31080757:-1 gene:ENSORLG00000017901 transcript:ENSORLT00000022411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRWTTNDRLLVPQKNKCVGAQGQSVGAEVKLYDCDEDSELQKWECRNQTLLGLKGKELF
IEIRTDHSAVLAKTTGPNSHFTISGTFDGACARTYREMFTTGGTAAGKPCMFPFMYGNQW
YSDCTMTDHTELWCAVETYYSSDSDKWGVCPTNSRQSWIKHPKTGAYYQLNSDAALTWAE
AESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLTLDPEHGWKWSSQNPFR
YLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCT
APWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWI
GLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRGQKGNWADSVCEEKHGFI
CMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSV
DNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPDQGDRQGCVAMA
TGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKLGA
KVKHHDKKTWYEAREYCTAIGGDLLSFHSKDDLVAGRGSLLTALWTYRHSRAWIGLSAPN
LDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQ
IPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATIN
SYNENAFLWKRISRSHGNYWIGLNVDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI
MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKD
QRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHGGEFYWSNG
RHLQYSNLMKYYPYLHLFSFERDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRFPQSDP
KSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYVELQ
VAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRSDQSCVYVDVGGKWKTSSCN
QTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTD
CSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWLGLYKTHKGTWKWLDRTVMDYTNWD
FHQPGMATYAEIATSDGMWKTGRPWNKRPYICKTAKIKERKSTMLTERLETFKNDTVPQP
HQARDHIALTVVVICAAAAVGAVIVIYVFRKSRHHLAVPPSMPNIINPLFFSGKQLETDA
DVDQLVENAKENPQVVKVK
Download sequence
Identical sequences H2MUE7
ENSORLP00000022410 8090.ENSORLP00000022410 ENSORLP00000022410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]