SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023043 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023043
Domain Number 1 Region: 354-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-66
Family SPRY domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-20
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 141-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000565
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023043   Gene: ENSORLG00000018411   Transcript: ENSORLT00000023044
Sequence length 541
Comment pep:novel scaffold:MEDAKA1:scaffold641:119049:131007:1 gene:ENSORLG00000018411 transcript:ENSORLT00000023044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIHGSFLSDDQFLCSICLDVFTNPSSIPCGHTFCMSCITRYWDQCELFQCPLCKKSFPK
RPILHVNRTLREITEQFKSMRGGVPVGNGKEDQTLSPGPDLCCPSTSTAVHGSANCLIAV
CAWLELYEAKAKILEYSRERKSLEQDLCLFDISVLPTMYCRTDQVCICPECEIEDHNDHD
TVTVEAEWMETKPKLQGSEQEIQEMIRERTRKIEEIKMSMTEVEMAVERETASSVCMFSM
LTSAIERSQAELIEVMEISRRAAEQQADSMIKQLEREIEELQIRDRALGELAQSDDHLHC
VKTFQTLSSPPPSKDWSGVSLNCDLGTSAVYRTLATMVKKFQEELQKVTESGVKRMQEYA
LDVTLDSHTAHPRLVLSEDLKIVWCGDRHQHMAENPERFDRVVCVLGQQPISSGKHYWEV
EVGGKTDWDLGVARQSISRKGKINYTPQNGFWFLSLRDKSKYAFRTEPSTDVNLNLRPHK
IGIFVDYEKGQVSFYNVDAKVHIYTFNDNFTENIYPFFSPCTNKGGRNDMPLIITPIVLT
E
Download sequence
Identical sequences H2MW28
ENSORLP00000023043 8090.ENSORLP00000023043 ENSORLP00000023043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]