SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023598 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023598
Domain Number 1 Region: 362-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-49
Family SPRY domain 0.000054
Further Details:      
 
Domain Number 2 Region: 10-73
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 144-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000111
Family B-box zinc-binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023598   Gene: ENSORLG00000018910   Transcript: ENSORLT00000023599
Sequence length 548
Comment pep:novel scaffold:MEDAKA1:scaffold5137:149:3518:1 gene:ENSORLG00000018910 transcript:ENSORLT00000023599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPELFSEQELTCSICLDLFTDPVSTPCGHNFCQACIGGYWASSQVCTCPLCKRQFDE
RPLLSINKVFALIADKYKRSTNPFLSPPPESQKVASVGGDVVWCDVCTGVKRPAVRSCLT
CTASYCNEHVQPHLTTPFYSKHPLMDPQEALRGRTCSMHRRLLEVYCRTCHRCICAICVL
EEHRTHKTVSVQTERLNKQKQMARTEQEILNRIREKESRLGDLRRKLEGLQNYAGRERGD
VENLLDQLSAALDRVRTQVVGRMESQLDPLVSKGESLVNRLEVELRQLNEKRAELEVQAS
SQDHIRFLQVRSSRRRRPGSPEPLETSPSPCRGDLMAADSMMSLRGSTASLRKSQWSLKD
VKRLKQVSEDVTLNPVTAYPFLILSEDRKQVKRGEKLQFFRNSPHRFDVWSCVIAKEGFS
SGRHYWEVFVGENKDWKLGVISESAQRKGLFDMSPSNGYYALWWSGNQLRALTAPPLTKV
KSHHPKLRQVGVFLDVEEAQVTFYNVKSGSEIYSFHGNAELTERMFPLLGTGDKEVPLIL
MTTQHHLA
Download sequence
Identical sequences H2MXD6
ENSORLP00000023598 ENSORLP00000023598 8090.ENSORLP00000023598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]