SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024002 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024002
Domain Number 1 Region: 78-170
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000246
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024002   Gene: ENSORLG00000019269   Transcript: ENSORLT00000024003
Sequence length 170
Comment pep:novel scaffold:MEDAKA1:scaffold637:6131:9354:1 gene:ENSORLG00000019269 transcript:ENSORLT00000024003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCCSVTQRHTGVDEVGPDEIELLELPGDSLGVWSPGEARLQLSLRNSRDEQQVQPPAPR
SSARLLEPEVVLWGRSREELHHRICSQQPIRGWEGQAAHLYGEVLHSSLVSLWDRHTQET
RELFLVLFPFHLLILALDHSRRDFAYQGILPLSGLSVKAEPDTSYSPHGF
Download sequence
Identical sequences H2MYC4
ENSORLP00000024002 8090.ENSORLP00000024002 ENSORLP00000024002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]