SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024072 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024072
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily POZ domain 1.1e-20
Family BTB/POZ domain 0.0035
Further Details:      
 
Domain Number 2 Region: 440-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 378-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000191
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 285-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000229
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000307
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 339-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000112
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024072   Gene: ENSORLG00000019331   Transcript: ENSORLT00000024073
Sequence length 647
Comment pep:known ultracontig:MEDAKA1:ultracontig85:521401:529176:1 gene:ENSORLG00000019331 transcript:ENSORLT00000024073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAESHHARRVLSSLNQQRATGRFCDAVLNVGQGELYLAHHSVLACFSELFKPSDNPAS
LSIEVSLNGCPGDGLQLLLNFIYTGNLKLDPSNLEKVQQAASSLCVPEVLALCQQFKETS
VDLVKRRRGRPRKSETSKALNEDLLPSASEDVSSLDFASFATGTRATTTRSGRVVKGPKR
LVSDGSPDSENTMVVVTAVEEEAAENLCPEAAETHDAVLQLDPHRNGEDDEDAEDFECVA
VDTDEEYAPVSEPTPSAQLVAKNPKAESQTSVDAVEDDSRTDSVSCATCHKSFKSKYYLK
VHNRRHTGEKPFTCQKCDKKYLRKESLFLHETRGCPIEQKHSCRLCSSSFDTKAELCSHI
VSHTGQMPYRCLTCHEQFMYKNSLTMHMMKLHGHPKPHACSQCPKTFLTRTVLRVHEATR
HRGEKPFVCEECGHRASSRNGLQMHIKAIHRNERPFVCNLCGHAFSQKNNLNMHLRIHSG
ERPYQCHLCGKTFRTQGCLDKHYRTHTGERPFTCDVCEKRFTEKGALLRHKASKHEEGRP
HCCHICGKTFKAKEQMRVHLRRHKGVRNFECSDCGYKFTRQAHLRRHSQIHKRTENYNPR
QRKLRNVIIQDEGEAANPGEAPNVIDASSDSTDLLSDLGSIRIVTVE
Download sequence
Identical sequences H2MYI5
8090.ENSORLP00000024072 ENSORLP00000024072 ENSORLP00000024072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]