SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024190 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024190
Domain Number 1 Region: 46-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 184-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000139
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 91-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000304
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 124-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000884
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024190   Gene: ENSORLG00000019433   Transcript: ENSORLT00000024191
Sequence length 460
Comment pep:novel ultracontig:MEDAKA1:ultracontig236:1275238:1276839:-1 gene:ENSORLG00000019433 transcript:ENSORLT00000024191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAMASGSQDHRRRFLEKAKLAPPSARRRRSEVKAKKNFLCPECQKSFNSLEKLKVHSYSH
TGERPYRCSQPDCTKAFVSKYKLLRHMATHSPEKTHKCSYCEKMFHRKDHLKNHLHTHDP
HKEAFTCRECGKSYNTKLGFKRHIALHAANSGDLTCQVCLQQFPSTGVLLEHLKTHSGKS
SGGTKEKKHCCEHCERCFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSH
ARELLRVKTEPTDLLGPVLDLPSGSIKAELLGMLTPKSHQPNTCPGLAVDPQPFFPPFSL
KYPLGPNVTSYSPSPHQREQALKGELETYLMELQSSTPSSSSATQEPQRSSSKPGMEPAE
SALEDPMSKMSTLAAVTTGDSLASSSPLMDFTQLFSFLPYSQVVGGSGPVNEEPAHLPQL
SAPPPTSPDAPENPLPGIPSSFLSSMSTPTTLPRFHHAFQ
Download sequence
Identical sequences H2MYT2
ENSORLP00000024190 8090.ENSORLP00000024190 ENSORLP00000024190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]