SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025312 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025312
Domain Number 1 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 522-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 116-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 210-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 5-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 51-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 485-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000633
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 402-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000583
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025312   Gene: ENSORLG00000020427   Transcript: ENSORLT00000025313
Sequence length 594
Comment pep:novel ultracontig:MEDAKA1:ultracontig222:715622:726833:1 gene:ENSORLG00000020427 transcript:ENSORLT00000025313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGRTFRQRHSMQSHMCTHSGERPFQCSDCGKSFYKQWRLKMHASTHAGEKPHSCDVCGR
RFNLLQNLRRHALMHTGEKRFTCSECGKGFTRAATLRTHQFIHTGQKPVKREQTPKTFTC
DLCGKSFRKAVNLKVHQRVHTGERPYSCHECGKSFRQALNLKIHQRVHTGERPYSCRECG
KSFTQQSSLNAHGRTHSTERPFCCRMCNKTFNNAYTLKLHVRVHTGEKPYACDLCDKSFI
RGTQLRTHQRDVHAGGKQYICDRCGKAYTYQCNLKLHNKDSNVHEAWSTLSCSVCGKSFA
TQSNLKSHFLIHTGEKPFACSVCGRAFRQRHSMQSHMCTHSGERPFQCSDCGKSFYKKWR
LKMHAISHTGEKPHSCDVCGRRFNLLQNLHRHALMHTGEKLFICSECGKGFTRAVTLRTH
QFIHTGQKPLKCEQCPKTFRHAVNLRNHLRIHSGERPFACELCGKSFRQAGQLKIHRRVH
TGERPFSCRECGKSFTQQSSLISHGRTHSTERPFACSSCNKTFNNANSLKLHVRVHTGEK
PYACDLCDKSFSQGSHLRTHQRHVHSGGKQYICDRCGKRYADQRNLKLHKCGFS
Download sequence
Identical sequences H2N1K6
ENSORLP00000025312 8090.ENSORLP00000025312 ENSORLP00000025312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]