SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025388 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025388
Domain Number 1 Region: 289-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000104
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 330-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 141-165,213-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000132
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025388
Domain Number - Region: 390-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000783
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025388   Gene: ENSORLG00000020493   Transcript: ENSORLT00000025389
Sequence length 770
Comment pep:known ultracontig:MEDAKA1:ultracontig115:3875236:3880097:1 gene:ENSORLG00000020493 transcript:ENSORLT00000025389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVGMFPVEASTVEDRPGLGSMPKNMLPAPQLVMLANVAAECGAGGDDSVADEKEMMELK
TVGCSYSDSEDESVIRYSYDNQNHLDICVINYPESPRNEGVAGGDLGAASQSQPRPSANT
PKEGAGDKDTPPNVDGLNKKKPFCCKPCRFQAQNKQQFVEHLSSHSISKMLVVNQVEGRS
KITAKEAETSEATPARSSEEAENGGEAASTGNEKKGLFKCERCGYNTNRLDHYMAHLKHH
SKEGEDHRVFKCTLCTYTTVSQYHWRKHLRNHFPSKLHTCSQCSYFSDRKSNYIQHIRTH
TGVRPFQCVYCDYSSSQKTHLTRHMRTHSGERPFKCESCPYLAANQHEVTRHARQVHNGP
KPLSCPYCEYKTADRSNFKKHVELHLNPRQFLCPLCKYAASKKCNLQYHIKSRHSGCSVE
LDVSKVKLRIKKPSTDGAEENSKASKSDGSSSFEEDMEDEDDHSSPINLSIKKSSRTNPP
GGTETTDKSAKKPRLMSEEEKPQKVKEQEKKISMRQKKVPEGETTPVTTDNKVKKRVKKV
QAVKKTDQDQAEEPPPEKHRAGEACQQQMSQEAHVKDQKVRPDKEKVPQRRDSSKPRKCG
SRKSEKKPDHIKEATEKPTTPAKKSKPKVVKVKPTKRRAAEALDLSQRSSKTRRLKAPAA
EKLPTKSPQQAESSPTDRSIRTLAAKTRKSSKKAPTERQIADPVPSSEAPETSTQPTRDS
PAGSSTEECADSCSATPGEPAASRAEDQHPPTFVKPTLPPLLPGQRSRPA
Download sequence
Identical sequences H2N1S5
ENSORLP00000025388 ENSORLP00000025388 8090.ENSORLP00000025388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]