SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025520 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025520
Domain Number 1 Region: 160-359
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-55
Family Prokaryotic proteases 0.000000612
Further Details:      
 
Domain Number 2 Region: 372-467
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-21
Family HtrA-like serine proteases 0.0027
Further Details:      
 
Domain Number 3 Region: 35-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000769
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 4 Region: 99-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000895
Family Ovomucoid domain III-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025520   Gene: ENSORLG00000020602   Transcript: ENSORLT00000025521
Sequence length 471
Comment pep:novel ultracontig:MEDAKA1:ultracontig214:305788:319367:-1 gene:ENSORLG00000020602 transcript:ENSORLT00000025521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTFASRTIIMRVVLWFSSVLLYLGGFANAEPKAKCPTRCDVSSCPSPSCPSGYVPDRCNC
CLVCAGAEGEPCGRKDDLPCGDGLECKHPAGKRLSKGFCQCKLGHRVCGSDGKTYRNVCQ
LKATSRAALQQGQPGVSQTHKGPCESSAGPSRTSSPRYKFNFIADVVEKIAPAVVHIELF
LRHPLLGRNIALSSGSGFVMTENGLIVTNAHVVSSSSPVKVQMHNGDVYEATIKDIDKKS
DIATIKINPQIKLPVLFLGQSADLRPGEFVVAIGSPFALQNTVTTGIVSSAQRDGKELGL
RDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLNDSLN
KHSKELRPIKKRFIGIRMLTITPALIEELKQQNSDFPNVTSGIYVHEVVPHSPAQKGGIK
DGDIIVKLNGKPLTSTSDLQAALQEETALLLEIRRDNDDLLFNIEPDVIMQ
Download sequence
Identical sequences H2N248
ENSORLP00000025520 ENSORLP00000025520 8090.ENSORLP00000025520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]