SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000001692 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000001692
Domain Number 1 Region: 590-618
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000204
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000001692
Domain Number - Region: 453-550
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0892
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000001692   Gene: ENSOANG00000001062   Transcript: ENSOANT00000001693
Sequence length 620
Comment pep:novel chromosome:OANA5:3:42807817:42896387:-1 gene:ENSOANG00000001062 transcript:ENSOANT00000001693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTKYLYGEGDL
NFSDDSGIAGLRNHMTSLNLDLQSQHVYHHGREGSRMNGSRTLTHSISDGHLQGGQSNSE
LFPQEPQTAPAQVPQGFNILGMPNPSSVSNSAPHLGFHLGSKGVSNLSQTPRFNPIMVTL
APNIQTGRSTPTSLHIHGVPPPALNSPQGNSIYIRPYITAPSGTSRQAQQPPGWVSQLSP
LHSQQVYQPSQPSPWTTFPSSSSQSHTSAQQPNQPNQPGHQTSHVYMPISSPTTPQPPLV
HSSGGSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRKNSTKLRSSGPRPSTLPLVNSQT
LTRSQPYCFTIAASPPNAEXVVTQPNTKYTFKITVPSNKPPAVSPGVVSPSFEPTNLLNL
PDHYVESEGIQHLTDPVLAHVDRISEARKLSMGSDDAAYTQALLVHQKARMERLQRELEI
QKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSSNRQLQIDIDCLTKEI
DLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIAKTPKTQDMEEDEGAQWNCTAC
TFLNHPALNRCEQCEMPRHF
Download sequence
Identical sequences F7CCG7
ENSOANP00000001692 ENSOANP00000001692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]