SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000001968 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000001968
Domain Number 1 Region: 19-168
Classification Level Classification E-value
Superfamily Spectrin repeat 1.61e-16
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000001968   Gene: ENSOANG00000001235   Transcript: ENSOANT00000001969
Sequence length 286
Comment pep:novel supercontig:OANA5:Contig6132:4229:16730:-1 gene:ENSOANG00000001235 transcript:ENSOANT00000001969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAVDHRKAIILSINLCSSEFTQSDSEESKDLQERLTQMNGRWDRVCSMLEEWRGSLQDAL
MQCQDFHEMSHGLLLWLENIDRRKNEIVPINPSLDSDTLQDHHKMLTQIRRELLESQLKV
ALLQDMSCQLLVNAEGQDCLEAKEKVHVIGNRLKLLLKEVSHHIKDLEKILDLSSSQLDC
GVCGSDSGSLGRAALEAFALEGKEEETTRLSLMPFLCSEPQPVRPRQSFFLRVLRAALPL
QLFLLLLVGLACLVPMTEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences F6YEJ2
9258.ENSOANP00000001968 ENSOANP00000001968 ENSOANP00000001968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]