SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000002761 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000002761
Domain Number 1 Region: 666-819
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-27
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 2 Region: 472-608
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-24
Family Spectrin repeat 0.0000358
Further Details:      
 
Domain Number 3 Region: 56-137,338-380
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 822-937
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 5 Region: 1002-1109
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 3-80
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000626
Family Spectrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000002761   Gene: ENSOANG00000001732   Transcript: ENSOANT00000002762
Sequence length 1109
Comment pep:novel supercontig:OANA5:Contig29797:575:13399:1 gene:ENSOANG00000001732 transcript:ENSOANT00000002762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRLQSQDLGKHLAGVEDLLQLHGLVEADIAVQAERVRAVSASALRFTAPGTGYKPCDPQ
LVSERVSALERGYEALCELAAARRSRLEESRRLWRFLWEVGEAEAWVREQQHLLASAEPG
RDLTGVLRLLIKHAALRDFFVRPWGYPPQSLVQCLAHSKRLIIIMMMMMLVFVKRLLCAE
HCSKCWGGHKGIRLSHVGLTVLIPILQMRELRHRKYSPEMGWILRPQTGLVEETLSATLE
VWSTGALMSSGEHGPGSQKDVGSNPGSPLVCCVTSHFTSLYLSYLICKMGIETVSPAWDR
DCVQPYLPSDSKRSTNAIIIIIVILHPPFPVRFETLEPEMNALAARIAAVNGIAEQLLSA
DPPGRDSIVATQDQLNNRWEGAGESRGWRGGGAMNLEQCSVHSKRLINIIIVIVPARQRR
LEKQLGAQRPGWTALCTSSALKERRPSRHKTERHQDGGRDGRKGEESGACGGAPAIKSRL
GEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEA
EALLAQHAGLRGEVERARGEYGRLRALGEEVTRDQADPQCLFLRQRLEALGTGWEELGRM
WESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADVAIKKLEDFLST
MDANGERIRGLLEAARRLVDGGNIHAETIQEKADSIEGRHKKNQDAVQQLLGRLRDNRER
QHFLQDCHELTLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKIDKEG
RALSSEKPELEPLVREKLKALHGRWEDLESTTQAKARSLFDANRAELFAQSCSALESWLG
ALQAQLHSDDFGKDLTSVNILLKKQQMLEREMAIREKEVEAIQAQAAALAQEERGAGAGA
GEVESTSRAVEEKFQALRKPLQDRCQRLLASREQHQFHRDVEDEIVTEGTEARGWKVTCP
RSHSRQVAELGLEPRQTLQKEVQGHEPRIADLRERQQALGAAARPELAARVAELRTLWDR
LGHELDQRGARLQEALRAQQFYRDAAEAEAWMGEQELHMMGREKAKDELSAQAEVKKHQV
LEQALEDYAQNIHQLALSSQDMIANNHPE
Download sequence
Identical sequences F7EZQ3
ENSOANP00000002761 ENSOANP00000002761 9258.ENSOANP00000002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]