SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000003443 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000003443
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000468
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000003443   Gene: ENSOANG00000002168   Transcript: ENSOANT00000003444
Sequence length 80
Comment pep:novel supercontig:OANA5:Contig69824:82:321:-1 gene:ENSOANG00000002168 transcript:ENSOANT00000003444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADVEAVRRAGEQLNGRWMDFCRLLADRLSWLEYQGSILTFYKELQELEQAVSSAESWWR
SQLPPAADTAAVRTQLESCN
Download sequence
Identical sequences F7ALL5
ENSOANP00000003443 ENSOANP00000003443 9258.ENSOANP00000003443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]