SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000003695 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000003695
Domain Number - Region: 30-68
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000003695   Gene: ENSOANG00000002332   Transcript: ENSOANT00000003696
Sequence length 123
Comment pep:novel chromosome:OANA5:1:25501055:25522085:1 gene:ENSOANG00000002332 transcript:ENSOANT00000003696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALK
RHTAQLREELLKLPCPEGLAPDSADSPEPCGATASPAEAPLHDPVKPGSSKDCPGDFKAI
SSC
Download sequence
Identical sequences F6YZT2
ENSOANP00000003695 ENSOANP00000003695 9258.ENSOANP00000003695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]