SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005262 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005262
Domain Number 1 Region: 504-825
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.2e-108
Family PDEase 0.0000000000219
Further Details:      
 
Domain Number 2 Region: 116-311
Classification Level Classification E-value
Superfamily GAF domain-like 9.16e-45
Family GAF domain 0.0000744
Further Details:      
 
Domain Number 3 Region: 296-499
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-37
Family GAF domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005262   Gene: ENSOANG00000003316   Transcript: ENSOANT00000005263
Sequence length 843
Comment pep:novel chromosome:OANA5:12:585863:682325:-1 gene:ENSOANG00000003316 transcript:ENSOANT00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPLRPLALAMLPFGDKTREMVNAWFAERVHTIPACKEGVRGHPESSSCPTQQTPHSEI
TAHGTPVRKISASEFDRPLRPIVVKDSIGTVSFLSDSEKKEQMPLQPPRFGPDAGDQCSR
LLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNEKFLISRLFDVAEGS
TLEEASNNCIRLEWNKGIVGHVAALGQPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPI
KNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQ
VLLDLASLIFEEQQSLEVILKKIAATIISFMQVQECTIFIVDEDCSDSFSSVFHMKFEEL
EDSADALKRDYDTNKINYMYAQYVKNTMEPLNIPDVCQDRRFPWTNENTENANQHIRSLL
CTPIKNGKKNKVIGVCQLVNKMEENSGKLKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAV
ERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQSLKLIDFSFSDFELSDLETT
LCTIRMFTDLNLVQNFQMKHEVLCKWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKSG
KIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSDHPLAQLYCHSIMEHHHFDQCLMI
LNSPGNQILSGLSIEEYKTTLKMIKQAILATDLALYIKRRGDFFELIRKKQFNLEDPLQK
ELFLAMLMTACDLSAITKPWPVQQRIAELVAAEFFDQGDKERKELNIEPTDLMNREKKNK
IPSMQVGFIDAICLQLYEALTHVSEGCLPLLDGCRKNRQKWQALAEQQEKNLINGESNQP
KRN
Download sequence
Identical sequences F7AEH8
ENSOANP00000005262 ENSOANP00000005262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]