SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006104 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006104
Domain Number 1 Region: 39-161
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-35
Family Spectrin repeat 0.000000542
Further Details:      
 
Domain Number 2 Region: 275-396
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-32
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 3 Region: 162-270
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-27
Family Spectrin repeat 0.00000273
Further Details:      
 
Domain Number 4 Region: 399-483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000691
Family Spectrin repeat 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006104   Gene: ENSOANG00000003847   Transcript: ENSOANT00000006106
Sequence length 498
Comment pep:novel supercontig:OANA5:Contig22840:6591:12315:1 gene:ENSOANG00000003847 transcript:ENSOANT00000006106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGWGSGITPLQASSNVPPSTSSQQAETAANRICKVLAVNQENEQLMEDYEKLASDLLE
WIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLS
NRPAFMPSEGKMVSDISTAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEA
WTDGKEAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYD
SPNVNARCQKICDQWDSLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGA
MEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEMTKIVQTYHVNMAG
TNPYTTITPQEINGKWDHVRQLVPRRDEALMEEHARQQQNERLRKQFGAQANVIGPWIQT
KMEEIGRISIEMHGTLEDQLNHLRQYEQSIVNYKPKIDQLEGNHQQIQEALIFDNKHTNY
TMEVPFPSPTASGCPQSL
Download sequence
Identical sequences F7BQQ4
ENSOANP00000006104 ENSOANP00000006104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]