SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006814 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006814
Domain Number 1 Region: 2264-2420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1825-1981
Classification Level Classification E-value
Superfamily Spectrin repeat 4.11e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 1494-1641
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 1047-1187
Classification Level Classification E-value
Superfamily Spectrin repeat 1.21e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 2415-2531
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 237-365,392-420
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 7 Region: 792-914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000106
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 2040-2200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000023
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 9 Region: 1718-1836
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000232
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 1402-1511
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 11 Region: 936-1041
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000523
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 12 Region: 1245-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000192
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 13 Region: 555-669
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000006814
Domain Number - Region: 33-172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00912
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 394-537
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0127
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006814   Gene: ENSOANG00000004293   Transcript: ENSOANT00000006816
Sequence length 2584
Comment pep:novel ultracontig:OANA5:Ultra546:1505856:1654013:-1 gene:ENSOANG00000004293 transcript:ENSOANT00000006816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGEHQQVLSNLQSRFEDFLEDSQESQIFSASDVTQLEREVNICKQYYQELLKSAEREE
QEESVYNLYISEVRNVRLRLENCEDRLIRQIRTPLERDDLHESVFRISEQEKLKKELDRL
KDDLTTITDKCEEFFSQAAALPSVPTLRSELNVVIQSMNQVYSMSSIYIDKLKTVNLVLK
NTQGAEALVKLYETKLCEEEAITADKNNIENLMSTLKQWRSEVDEKREVFHALEDELQKA
KTISDQMFKTHKERDLDFDWHKEKADQLAERWQNVHAQIENRLRDLESIGKSLKYYRDTY
HPLDDWILHVEDTQRKIQENQPDNSKTLATQLNKQKMLVSEIEMKQNKMDECQKYSEQYS
TAVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADVIVQEFMDLRTRYTALVTLMTQYIK
FAGDSLKRLEEEEKSVQEEKKEHVEKAKDLLKWVSNVSKTLKGEGEKSGKKPFSKHQISS
EEISAKKEQISEALQTAQLFLAKHGDKMTDEERREMEKQVKSLESCNLLFSETLKELQDS
QIVRDEEVEEKLVAKRQQEYKEKLQGICDLLTQTENRLIGHQEAFGGGDCKTELKHYQAK
QEELQKDMQASAQAMAEIVKNTEKFLKENEEKLSQEDKALIEKKLNEAKTKCEQLNQKAE
ESRKELDKAVTTAIKQESEKVAAVEQLEESKNKIEDLLDWLSNMDKDAERAGKKCKQPIE
QNGTHYQEGSVKSVIGEEDEVNGNLLEFQQHTESDGGEFKTSEKNLNQQYQKVKAQHEKI
VSQHQAVIIATQSAQALLEKQGHYLSPEEKEKLQRNMKELKVQYETALAESERKMKLTHS
LQEELEKFDTDYGEFESWLQQSEQELENLEAGADDLSGVMTKLKRQKSFSEDVISHKGDL
RYITISGHRVLEAAKSCSKRDGVKGDKDTVDTSATYKEVQSKLDNATERFKSLYSKCSIL
GNNLKDLVDKYQHYEDASSGLLPGLQASEVAVKKHLSEPIAVDPKNLQRQLEETKALQGQ
VSSHQVAVEKLKKASEVLFDARGPLLPDKNEIQKTLDDVIGRYDNLSKSINERNEKLQIT
LTRSLSVQDGLDEMLDWMESVENSLKEQGQVPLNSAAIQDIISKNIMLEQDIAGRQSSIN
AMNEKVKKFMETTDPLTASSLQAKMKDLSVRFSEASNKHKEKLTNMEELKTKVELFENFS
EKLQSFLETKTQVLVETDGPGKDVTELSQYMQESTNDFVEHRKDLEVLQNLLKDLSAYGL
PGDKALILEKTNALSKKFKEMEDTMKEKGEAVSSCQEQMDAFWLLVESLKTWMEETLERI
PAVQSSLGMDDLKKSLEATKLLQEMWNLKAPEIQKVNNRGSSLCNLISAVTSPAKARTMV
KSGGAVLNGEGTASNTQEVLTNKDMTSVKKDMTDINHSYEDLGILLKDNISELEMKLSKL
QKVQEESNSMIQWLQQMDKNTTSWDAPPTDNEAVRAQFEQNKTFEAELKQNVNKVQELKD
KLSELLEQNPDSPEAPKWKHMLEEIDSKWKELNQLTADRQQKLEESSNNLTQFQTVEAQL
KQWLVEKELMASVLGPLSIDPNMLNTQKQQVQILLNEFDTRKPQYEQLKTTGQSILNRPG
EHPPLHGTVKEQLAAVAEKWDSLTGQLRDRCIRIDQAIDKSTQYQSLLRSLSDKLSVLDN
KLSSSLAESAHPDAMKQQLEAAREMEQEIEQEMKNLKLAQVLCEDLSALVGEEYLKAELS
RQLEGIFKMFKDIEQKAGHHVQQLQSACASSHQFQQMSQEFQVWLDTKKEEQNQSPPISA
KLECLQSLIKDQKEFQKSLTSQCDSYKKIVAEGENLLLKTQGAEKADLQVQINTIKTNWD
GLNKQVVERQEELKDCLEKALKYKEHVENLQPWIDKCHNNLAEIKVCIDPAGTENSIEKV
KALQKEMDQHFGMVELLNNAANSLLNASEIDQEAIREGNKSLNQRVDTLTEQLQSKKQSL
ENMSKKLKEFQEASKETQRLLKGAKEQLEVYDSLGPQACSNKHLTIMQSQQKSLQTLKHQ
VEMAKKVAQELVVEASDSEGTADLLIQAESLEREHRDVSQQVEDKCSFLEAKLQGIGHFQ
NSIREMFSQFAEFDDELDSMAPVGREGDTLQRQREDIKDFLKKLQDLIVSNGNANKTCKM
MLASEEASPDLVGIKRDLEALSKQCNKLLDRAKVREEQVESTVSRLEEFYEKLKEFSGCL
QRAEENEESQGPVGMETETINQQLNIFKMFQKEEIDSLQAKQQEVNWLGQGLIQSAAKST
STERLEHELEDVNTRWKTLNKKVAQRAAQLQEALLHCGRFQDAMESLLSWLVDTEDLVAN
QKPPSAEFKVVKAQIQEQKLLQRLLDDRKPTIEVIKREGEKIAETAEPADKVKILKQLSL
LDSRWDALLNKAETRNRQLEAISVVAQQFHETLEPLVEWLTITEKKLANSEPIGTQTPKL
QEQIAQHKALEDDIINRNKNLHQAVSIGQSLKVLSSREDKEMVQEKLDATQARYIELQDK
STSRSELLQHAHSNAQIFGEDEVELINWLNEVHDKLSKLSVQDYTTEGLKHQQTELLSLN
SELN
Download sequence
Identical sequences F6URP4
ENSOANP00000006814 ENSOANP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]