SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006816 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006816
Domain Number 1 Region: 403-687
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.96e-96
Family PDEase 0.00000076
Further Details:      
 
Domain Number 2 Region: 189-380
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-48
Family GAF domain 0.0000305
Further Details:      
 
Domain Number 3 Region: 32-181
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-20
Family GAF domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006816   Gene: ENSOANG00000004294   Transcript: ENSOANT00000006818
Sequence length 688
Comment pep:novel ultracontig:OANA5:Ultra215:358315:445280:-1 gene:ENSOANG00000004294 transcript:ENSOANT00000006818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSHGMKYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLG
ECNNSLCVFTPPGAKEGKPRLIPAGPIAHGTTISAYVAKSRKTLLVEDILGDERFPKGTG
LESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFHLTHQEVATANLSWASVAIHQVQ
VCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDQKNKE
LYSDLFDIGEENEGKPIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDL
YTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMY
HRIRHSECIYRVTMEKLSYHSICTAEEWQNLMHFTLPSLLYKDVELYHFDISPFEDMWPA
IFVYMIHQSCGPACFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNQGLF
TDLERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGH
NIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMHQKGSLNLNNQAHRDRVIGL
MMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLG
FYNAVAIPCYTTLTQIFPPTGPLLRACR
Download sequence
Identical sequences F6URL1
ENSOANP00000006816 ENSOANP00000006816 9258.ENSOANP00000006816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]