SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007650 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007650
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-39
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000221
Further Details:      
 
Domain Number 2 Region: 176-272
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.83e-34
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 351-462
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.49e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007650   Gene: ENSOANG00000004830   Transcript: ENSOANT00000007652
Sequence length 474
Comment pep:novel chromosome:OANA5:10:976925:1008546:-1 gene:ENSOANG00000004830 transcript:ENSOANT00000007652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSNSVFQTMSSAVVQIYAADRNGMWLKKCCGVACLVKDNPQRSYFIRIFDIKDGKLLWE
QELYNNFVYNSPRGYFHTFAGDTCQVGLNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDP
PNGPNLPMATVDIKNPEITTNRFYNPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQH
IGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDKETSKVIYDFIEKTGGVEAVKNE
LRRQAPPPPPPSRGGPPPPPPPPHSSGPPLPPARGRGAPPPPPPSRAPTAAPPPPPPSRP
GTTDPPPPPTGMYPPPPPAHPSSAPSGPPPPPPPLSVGSAAPPPPPPPPPPPGPPPPPGL
PSDGDHQLPAPVGNKAALLDQIREGAQLKKVEHNSRPVSCSGRDALLDQIRQGIQLKSVS
DGQESAPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences F7E2I0
ENSOANP00000007650 ENSOANP00000007650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]