SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007707 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007707
Domain Number 1 Region: 31-173
Classification Level Classification E-value
Superfamily PH domain-like 9.43e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007707   Gene: ENSOANG00000004861   Transcript: ENSOANT00000007709
Sequence length 260
Comment pep:novel supercontig:OANA5:Contig13458:1655:23353:1 gene:ENSOANG00000004861 transcript:ENSOANT00000007709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTETELQVAVRAGTRRDSRRKGQGRSEAALIRRFKGDGARYKAKLIGVDEVAAARGDKL
CQDAMMKLKGVVAGARAKGEHKQKIFLTVSFGGIKIFDEKTGALQHHHAVHEISYIAKDT
TDHRAFGYVCGKEGDHKFVAIKTAQAAEPVILDLRDLFQLIYELKQKEEVEKKAQKDKQC
EQAVYQTILEEDMEDPVYQVTAEVWATSGRSDVEVAHGPSPEQGGGLDEGGFSVRGRTQR
SVGGGDREQGIVLSTWRAIQ
Download sequence
Identical sequences F7G017
ENSOANP00000007707 ENSOANP00000007707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]