SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007829 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007829
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 3.49e-30
Family SAND domain 0.0000102
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000007829
Domain Number - Region: 248-345
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0302
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007829   Gene: ENSOANG00000004939   Transcript: ENSOANT00000007831
Sequence length 533
Comment pep:novel ultracontig:OANA5:Ultra337:3631215:3675912:1 gene:ENSOANG00000004939 transcript:ENSOANT00000007831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDNAVDGSGVEEVKTVLVTTNLAPHGGDLTEDNMETENAAAA
AAAAFTASSQLKEAVLVKMAEEEENLEAEIVYPITCGDSKANLIWRKFVCPGINVKCVQY
GEHVLSPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSQTSTEYIPITPASADVNGSPATITIETCEDAGDWTTTIGDDTFSFWRGL
KDAGLLEEVIQEFHQELVETMKGLQHRVQDPPLQLRDAILLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYTRDLAALEQQCDEHRKRAKELKHKSQHLNNVLMTLTPVSLPTPIKRPR
LTRATSGPAAIASQVLTQTAQIALTQGVPVSQLANLPLGKVVSTLPSSILGKGSTQVSPA
NSPASPLLGGYTVLASSGTNFPGTVEIHPDASNLTVLSTAAMQDGSTVVKVVSPFQLLTL
PGLGTTIQNVTQVSPSGSTIVTVPSSAVESAAVSEEHATTIEVTTVAEEPDQK
Download sequence
Identical sequences F7E279
9258.ENSOANP00000007829 ENSOANP00000007829 XP_001511013.1.37387 ENSOANP00000007829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]