SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011417 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011417
Domain Number 1 Region: 2151-2388
Classification Level Classification E-value
Superfamily Plakin repeat 3.84e-84
Family Plakin repeat 0.000000000843
Further Details:      
 
Domain Number 2 Region: 1909-2144
Classification Level Classification E-value
Superfamily Plakin repeat 2.79e-75
Family Plakin repeat 0.00000229
Further Details:      
 
Domain Number 3 Region: 2462-2502,2548-2742
Classification Level Classification E-value
Superfamily Plakin repeat 2.09e-66
Family Plakin repeat 0.0000000149
Further Details:      
 
Domain Number 4 Region: 785-905,932-959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000384
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 5 Region: 267-396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2400-2455
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000628
Family Plakin repeat 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000011417
Domain Number - Region: 130-212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000187
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 712-823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0312
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011417   Gene: ENSOANG00000007176   Transcript: ENSOANT00000011419
Sequence length 2806
Comment pep:novel ultracontig:OANA5:Ultra474:1612694:1646491:1 gene:ENSOANG00000007176 transcript:ENSOANT00000011419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLGRSRELDECFAQANDQMD
ITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISAPRVRKASSKGGGGYTCQSGSG
WDEYTKRLTSECLGWMRQQKAEMDMVTWGVDAASVEQHISSHRSVHNAIGDYRWQLDKIK
ADLREKAAIYQLEEEYENLLKSSFERMDHLRQLQSIIQATSREIMWINDCEEEELLYDWS
DKNTNIAQKQEAFSVRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWS
WILQITKCIDVHLKENSAYFQFFEEAQSTEAYLKGLQDSIRKKYTCDKNMSLQRLLEQIK
ELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKG
DECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSSKIEQYYEAILALWNQ
LYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTISDLEVHYQEFIRNSQGSEM
FGDDDKRKIQTQFTDAQKHYQTLVIQLPGHHQHQTVTTTEITHLGSCKDTNHNQIIETNR
ENDKQETWMLLELQKIRRQMEHCEGRMTLKNPLIPDQGTSHHITVKINELKGVQNDSQAI
AEFLNQLKDMLANFRGSEKYCYLQTEVFGLFQKLENINGVTDGYLNSLFSVRGLLQAILQ
TEDMLKVYESRLTEEETVCLDLDKVEAYRCGLKKMKTDLNLKKSLLATMKTELQKALQID
AQTSQQYPLYDLDLGKFTEKVTQLSDRWQRIDKQIDYRLWDLEKQIKQLRNYRDNYQAFC
KWIYDAKRRQDAIESMKFGDSNTVMRFLNEQKNLHNEISGKRDKSEEVQKVAELCANSIK
DYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAAEIHARYIELLTRSGDYYRFLSE
ILKSMEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQVECSQFKAKLVSL
EELKRQAELDGKSAKQNLDKCYGQIKDLNDKITRLTYEIEDEKRKRKTVEDRFDQQKNDY
DQLQKARQCEKENLGWQKLESEKTIKEKEYEIERLRVLLQEEGARKREYENELAKVRNQY
NEEMSNLRNKYETEINITKTTIKEISMQKEDDAKSLRIQLDRLSRENRDLKDEIVRLNDS
ILQATEQRRRAEENAMQQKACGSEIMQKKQQLEIELKQVIQQRSEDNMRHKQSLEEAAKT
IQDKNKEIERLKIEFQEEAKRRWDYENELAKVRNCYDEEIISLKNQFETEINITKTTIHQ
LTMQKEEDTCGYRAQLDNLTRENRSLSEEVKRLKNTLAQATENLRRVEETAQQQKASGSE
ISQKKVQLEIELKQVTQMRSEESMRYKQSLDDAAKTIQDKNKELERLKKLIETETSQRKA
LEDENAKLQRAQFDLQKANSSVTETITKLRIQEQEMARLKIDYERLSQERVGKDQDIAKF
QTSLKDLQFQKQKVEEELNRLKKTASDESSRRKKLEEELEGMRRSLKEQAIKITNLTQQL
EQASIVKKRSEDDLRQHRDVLDGHVREKQRTQEELRKLAAEVEVLRRQLLQEQENVKQAH
LRNEHFQKVIEDKSKSLNESKIEIERLQSLTENLTKEHLILEEELRNLRLEYDDLRRGRH
EADNDKNVTISELRSQLQTSNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQ
ESKSQCTQVVQERESLLVKIKVLEQDKMRLQRLEDELNRAKATLESESRLKQRLECEKQQ
IQNDLNQWKSQYSRKEEAIRKIESEREKSEREKNCLRSEIERLQAEIKRIEDRCRRKMED
SSRETQSQMDAERCRLQREIEKLKQRPYGSHRETQTEDEWAIDPSKLMFDGLRKKVTAMQ
LYECQLIDKATLDKLLKGKKSVEEVASDIEPFLRGAGAIAGASASPKDKYSLVEAKRKKL
ISPESTVMLLEAQAATGGVIDPHRNERLTVDNAIARDLIDFDDRQQIYTAEKAITGFNDP
FSGKTVPVSEAIKKNLIDKETGLRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLY
RSLNDPRDSQKNFIDPVTKKKVSYMQLRERCRIEPHTGLLLLTVQKRSMSFQGIRQPVTV
TELVNSGILRPSTVNELESGQISFDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMK
IGLVRPGTALELLEAQAATGFIVDPVGNQRLPVEEAYKRGLVGIEFKEKLLSAERAVTGY
KDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVEMAYKRGYFNE
ELNEILLDPSDDTKGFFDPNTEENLTYLQLKERCMKDELTGLCLLPLKEKKKQFQTSQKN
TLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFVELCEQECEWEEITITGSDGSTRVVL
VDRKTGNQYDIQEAIDKGLVDRKFFEQYRSGSLSLTQFADMISIKNGGGVGVGGAGDEVF
SSSRHESVSKSSSISGIRNLTIRSTSLSDPLEELSPIAAIFDTENLEKISISEGIQRGIV
DSITGQRLLEAQACTGGIISPTTGQKLPLQDAVSQGLVDQDMATRLKPAQKAFVGFEGVK
GKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLIDPEMNGRISTEEAIRKGLIDGRAAQ
KLHDTGNYAKILTCPKTKLKISYKDAMNRSMVEDITGLRLLEAASVSSKGLPSPYNVSSA
PGSRSGSRSGSRSGSRSGSRRGSFDASGSSSYCYSYSSFSSSSIGH
Download sequence
Identical sequences F6XYV3
ENSOANP00000011417 9258.ENSOANP00000011417 ENSOANP00000011417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]