SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000011738 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000011738
Domain Number 1 Region: 46-155
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 148-234
Classification Level Classification E-value
Superfamily EF-hand 0.000000242
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000011738   Gene: ENSOANG00000007376   Transcript: ENSOANT00000011740
Sequence length 307
Comment pep:novel supercontig:OANA5:Contig32876:2516:12337:1 gene:ENSOANG00000007376 transcript:ENSOANT00000011740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSLNPTASPYTWFTIELLESILLEASASFQEHEEELQREEKRQLKNNEMCQEFEQLASAF
SQWIQESRAYFLDGSLLKETETLESQLEANKRKQKEIQVMKRQLTKIEDLGESMEEALIL
DIKYSTIELAQQWDQLHELGMRMQHNLEQQIQARNTIGVSEETLMEFSTAYKHFDENLTG
HLSHKDFKSCLRGLNYYLPMVEDDEPQPKFEKFLDAVDPDRFGRMLWDMYTSAVGLGEGE
MNKGIKLGQHRREWGKRKANNNNRKRSLTPEQAEFCISHMQPYVDTRGRGHVAGYDYAGF
TQEFFGK
Download sequence
Identical sequences F6QM83
ENSOANP00000011738 ENSOANP00000011738 9258.ENSOANP00000011738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]