SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013312 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013312
Domain Number 1 Region: 118-409
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.85e-70
Family PDEase 0.00000331
Further Details:      
 
Domain Number 2 Region: 6-51
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000386
Family GAF domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013312   Gene: ENSOANG00000008377   Transcript: ENSOANT00000013315
Sequence length 412
Comment pep:novel supercontig:OANA5:Contig29549:1259:11517:1 gene:ENSOANG00000008377 transcript:ENSOANT00000013315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGPVDETGWVIKNVLSLPIVNKKEEIVGVATFYNRKDAKPFDEYDEQITEETSSVRNSVG
LLDSARAWESEDLGSNLSSASCLLCDHLVEEGNEGQSWRRPRAAWAELLGLTALFALVLT
RWMYTVRKGYRSITYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMVAAAFCHDIDH
RGTNNLYQMKSAAPLARLHGSSIMERHHLEYSKTLLQDESSRNSLQQNLNKRQFETLIHL
FEVAIIATDLALYFKKRTMFQKIVDACEKLDTEEEAIKYISIDPTKKEVIMAMMMTGCDL
SAITKPWEVQSQVGQWTVWPFGDLGRTTLSSSEARFTQRDWLLLPKVSLGPSSYLGTSDT
KEFSRFHKEITPMLDGLQNNRVEWKSRADEYDAKMKVLEEEKKKQEEEAAKK
Download sequence
Identical sequences F6XN91
ENSOANP00000013312 ENSOANP00000013312 9258.ENSOANP00000013312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]