SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013748 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013748
Domain Number 1 Region: 539-844
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-115
Family PDEase 0.0000000826
Further Details:      
 
Domain Number 2 Region: 131-329
Classification Level Classification E-value
Superfamily GAF domain-like 2.05e-45
Family GAF domain 0.0000509
Further Details:      
 
Domain Number 3 Region: 313-515
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-41
Family GAF domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013748   Gene: ENSOANG00000008626   Transcript: ENSOANT00000013751
Sequence length 867
Comment pep:novel ultracontig:OANA5:Ultra514:15742333:15869386:-1 gene:ENSOANG00000008626 transcript:ENSOANT00000013751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTDGGTAPGGSKDGMGTEGGTAPPGSSGGGGPRGGWGLRRRASQKELRRTFARSKACPA
TRTYEEPAGVSALARPQERPGGGRRRAMLRKASSLPPTSAHILSALLESRVSLPQCPPTA
LDYKCHLRRHSQPHFFLELVKDVSNDLDLTSLSQKILVFVRLLVDAHRGSLFLVEATAAG
KKTLVAKVFDGQAGTPLRPHGSAHDPSEVQVPWGQGIVGYVGERGETVNIPDAYQDHRFN
DEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKTPGGTRFTEDDEKVMEMYLPFCGIA
IANAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLE
DIESPVVKFAKSFELMSPKYNADAENSFKDSVEKSPYSDWLTNNSIVELVASTGLPVNIS
DAFQDPRFDAEAEQFSGFHIRSVLCVPIWNSSHQIIGVAQVLNRLDGKPFDNADQRLFEA
FVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAASIPPVSELAIG
DIHFNDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHA
FNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGT
SATLEHHHFNHAVMILQSEGHNIFAKLSSKDYSDLMQLLKQSILATDLTLYFERRTEFFE
LVQKGNYNWNLQQHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERAEL
KLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNGKLKPMLDSVAANRSKWEEMH
LKQLLTQAPSSPSSSSPSVPGPAADIN
Download sequence
Identical sequences F6WM73
ENSOANP00000013748 ENSOANP00000013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]