SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013778 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013778
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000122
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 208-301
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000101
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 635-721
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000032
Family Spectrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000013778
Domain Number - Region: 342-496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 132-237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0206
Family Spectrin repeat 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013778   Gene: ENSOANG00000008645   Transcript: ENSOANT00000013781
Sequence length 847
Comment pep:novel ultracontig:OANA5:Ultra514:16502502:16606444:-1 gene:ENSOANG00000008645 transcript:ENSOANT00000013781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEENSEGHLSTTTVSSVAVQAGDSRIVIAVLKCGQWVQLQLVESHPNLLEIGSSQDET
NKLLQDHELLLAKLKALEGRVWDLLREADKAAEENSAQGQVYDAMAETLGEAWAALVTVL
EKRRALLKLTAEFFENALEFAMKIDQAEDFLQNAQEFESTESLKSILQLHEHHTKELLER
SLALLNKSRQLTDYIEEFKSEGANVTSELTQGAHCSCLKIDSLLELLQDRRRQLDKYLKS
QGQELEQVLQICQWDQQESQVTCWFQNNIEGLPKQSLGSSLSENEELICKHNELLFEAKA
FDELGRIEAYLKLLQSEGLSLPLLAMKQEKLPSKMRECSADALQKGQVLISQGGADSSQM
AGIQKMMGCIEKRLDQLTQQCSAYKELALKKQQFSASVEGYLQKASMLIQNISPELSNGV
DVGSCLSESERILSKYQELDSQAKETACELEAAVRTMKEKDELEPVEVDSLSGKADLLMR
DLKILGRNIGSKLQILQIYVAFLKSSQEVEAQGQILKGFYQNKIAQTEDEEAKSKAVVES
SDRDWHLFLKKSFSAQDLGCDCLDLINMANENLLLKAKNIIHLTENTLENLRQERERLTH
LWLSWQLHVNHTKPIKQQCGAFKEHFKKTIHSLKLLQEVIMPVSALDLGSNLQTLLELQK
KCKHMKPQVQHLHAEVQYAVKAAELLHLKGIPGKEKSEKLKEMTQLYQKVEEKMKNYETI
LNKTVRFHHAKEELENLIKSSELEFPEPSGETEDVYSAKAHLSRSQERQSHIRHLYQLAL
TLGMEIISEVQRPNCSNVSAKILQQQLEKLESDSMNWHSKADQYEEKLSRNFQYCTTREE
INEVCWK
Download sequence
Identical sequences F6VRR9
ENSOANP00000013778 ENSOANP00000013778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]