SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013780 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013780
Domain Number 1 Region: 462-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000013780
Domain Number - Region: 244-372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 40-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000249
Family CRAL/TRIO domain 0.013
Further Details:      
 
Domain Number - Region: 376-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00352
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013780   Gene: ENSOANG00000008646   Transcript: ENSOANT00000013783
Sequence length 696
Comment pep:novel ultracontig:OANA5:Ultra514:16616664:16675619:-1 gene:ENSOANG00000008646 transcript:ENSOANT00000013783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATIILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMEELSVTLDYLLSIPSEKCKA
RGFTVIVDGRKSQWNVVKTVVLMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRL
GFEVILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALI
NNGSDKGNQQEKERSMDLNFLPSVDPETVLQTGHELLSELQQRRFNGSDGGVSWSPMDDE
LLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRTQW
GIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLS
DVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL
EEKLKSVDIGLQGLREKGQSLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQ
RCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEK
HRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHR
LEMTIAFHSTAEKILQECPEQPEAIHDEEQFDEIEAVGKSLLDRLTVPVVYPDGNEQYFG
SPSDMASTAEHIRERMKLVSLKRQQLRQPEAASIDS
Download sequence
Identical sequences F6VRH2
ENSOANP00000013780 ENSOANP00000013780 XP_001515483.1.37387 XP_007669475.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]