SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014087 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014087
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-66
Family Calponin-homology domain, CH-domain 0.00000265
Further Details:      
 
Domain Number 2 Region: 195-316
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-33
Family Spectrin repeat 0.0000784
Further Details:      
 
Domain Number 3 Region: 1434-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-28
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 1542-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-28
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-27
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 6 Region: 912-1067
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-27
Family Spectrin repeat 0.00000671
Further Details:      
 
Domain Number 7 Region: 1130-1277
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-25
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 8 Region: 715-837
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-22
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 325-425
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 10 Region: 645-749
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 11 Region: 429-536
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-17
Family Spectrin repeat 0.00054
Further Details:      
 
Domain Number 12 Region: 1233-1365
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 13 Region: 1883-1974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000051
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 14 Region: 1694-1811
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000681
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 15 Region: 1357-1450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000122
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 16 Region: 840-938
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000134
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 17 Region: 1807-1909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000202
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014087
Domain Number - Region: 1072-1156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00619
Family Spectrin repeat 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014087   Gene: ENSOANG00000008848   Transcript: ENSOANT00000014090
Sequence length 1978
Comment pep:novel ultracontig:OANA5:Ultra164:31140:94023:-1 gene:ENSOANG00000008848 transcript:ENSOANT00000014090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQ
DIVVQTQEGRETRSAKDALLLWCQMKTAGYPNVNVNNFTSSWKDGLAFNALIHKHRPDLI
DFEKLKHSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKM
KVLAVEGKRVGKVIDHAMETEKMIDKYSGLASDLLTWIEQTIAVLNSRKFANSLDGVQRQ
LQTFSSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHEGKLVSDINRAWESLE
EAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGCDLAAVEAA
KKKHEAIETDTAAYEERVKALEKLAQELEQENYHDVKRIKAHKDNILRMWAYLLELLQAR
RHRLELTLALQKLFQDMLHSIDWMDELKIHLLSSEYGKHLLEVEDLIQKHKLLEADISIQ
ADKVRSIGEAALQFASGKDYQPCDPQVIEDRVKHLELCFGELSSMAAGRKARLEQSKRLW
KFIWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLEAHLEQAIHEA
EGMVVRKHFGHPQIEARIQAVSVLWSQLQELAAFRKKNLQDAENFFQFQGDADELQTWLR
DALRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVLEHLEQQAQGFPQEFQDAPEVG
SRLTAIRELYQQVLAQADLRRQRLQDALGLYTVFGETDACELWMSEKEKWLEQMDLPDTL
EDLEVVQHRFDILDQEMKTLMVQIDGVNQAANSLVDSGHPRSKEVKKCQDHLNDRWRGRK
FQALVLERRKAVDSALSVHNYCVDCEETGKWILDKTKVVESTQDLGRDLAGVIAIQRKLY
GLSRDVTAIRGRMGALTQESQRLVEEHPELEEDITKRQNYIENLWKGLQEALKGQEASLG
EASQLQQFLQDLDDFQAWLFTAQKTVASEDAPESLPEAEQLLQQHATIREEIDGHLEDYQ
KVKAAGERVTQGQSDPEYLLLGQRLEGVDIGWEALGKMWENRGHFLKQCLGFQEFQKDAK
QAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLATMKSNNTKILGAVDSGNELLAEG
NIYSDKIGEKVQQIEDRHKRNNERSQEVEHLLKDNLDLQNFLQNCQELTLWINDKLLTSQ
DVSYDDSQNLHNKWLKHQAFMAELASNQAWLEKVDEEGKQLIEQKPQFAAVVTPRLDMLH
RLWDELQSTSQEKAQRLFDANRSDLHAQTYADLNKWISEMEEQLRSDDQGKDLTTVNRML
AKLKRVEDQVNVRKKELGELLSLGSALGDEEEREEPSIERRFLDLLEPLEKRRKELQSSK
AKLQINRDLEDETLWVDERLPLAQSTDYGTNLQTVQLLMKKNQTLQNELTGHAPRIEDVL
QRGQEMVASADIDCRDIEEWLGSLQGSWDTLQGATAQRLQRLQDASEAQQYYLDAGEAEA
WISEQELYVISDETPQDEESAIVMLKRHLRQQQAVEEYGKNIKQLAGRAQWLLSAGHPEG
EQIIRLQGQVDKQYAGLKEMAEERKRKLENMYHLFQLKRETDDLEQWIAEREVVASSPEM
GQDFDHVTLLRDKFRDFARETGAIGQERVDHVNAVIERLIDAGHAEAATIAEWKDGLNES
WADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVH
TAFERELHLLGVQVQQFQDWATRLQTAYAGEKADAIQNKEQEVSSAWQALLDACAGRRTQ
LVDTADKFRFFSMVRDLLSWMESIIRQIETQEKPRTPELIQESLRVHYAAPAHPSCRNDL
GQSNSLPLFKSLLKTRLLQEAFPIKVKLTQVTERRQEMMEKWNTRWNQLSLLLEVCQFSR
DASVAEAWLIAQEPYLASRDFGHTVDGVEKLMKRHAAFEKSTATWEDRFAALEKPTTV
Download sequence
Identical sequences F7FQR7
ENSOANP00000014087 ENSOANP00000014087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]