SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014492 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014492
Domain Number 1 Region: 348-502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000768
Family Spectrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014492   Gene: ENSOANG00000009102   Transcript: ENSOANT00000014495
Sequence length 763
Comment pep:novel supercontig:OANA5:Contig283:862750:886767:1 gene:ENSOANG00000009102 transcript:ENSOANT00000014495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHVPLSYKEALEHLEQTKGLVLNLLSMEETLMGLRQDLKHLNPLCTEKSNLCLLKMVSA
LWEKWLSFLEIATEWEMSCEELKQEWKFVSEEIEREAIIVDNLQEELPESTKAKEKATKE
ELSESLEYLWHFEESLDRQQLLLTLLLQRQKSVLNVPAVLELIETVPAVQEIRSMQDRCN
KLYQKVQKNKELVQTEVRERDSISKEIIALKNLFQNTVNSFHEMEMQDQTEEAQQFEEIQ
RIITKEKLTLENIMEKLRIKYSEMYCIVPAEIETQVEECKKALERVEEKVRNKILESSPP
FMMNRKIEDINNGLRNAEKMLQQKSKNIEEAQEVQKKIWDELDLWHSKLNELDSEVQDLV
EQDPGQAQEWMDNLMVPRQQYQQVSQRAEYRTSQLNKATLKMEEYNELLKGTEIWIDKTS
CLLADPVDYDSSKALSQHATKLQMALEDSEQKQNLLHSIYSELEQLSVILETKDVAQLPN
QLSDQVSTLQQEIMGRLPQLQDMADEVTAIELEVKSMEKKFAKIKSILLSKDIFDFSPKE
HLKHGEVILDNIHPMKKTIGEIKSYGTIVKFPGAGTKPLPVFERTNQLLQDVKVLEKVTQ
EQNEQLKMTIIQTDECDQEIENLKLLLKNYSSESLPEETITSPQGQGGIHEVEEQILKLN
QKKEDLLMGLKSSLQELHRHLHLEPEEGDSEVPAAVTATEESGGAARGVCEWKVKRKGSM
SLLPSVVEEVEESSLKSEVRFLLFMLFWGREECIRVLEEDILQ
Download sequence
Identical sequences F7G1U2
ENSOANP00000014492 ENSOANP00000014492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]