SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014498 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014498
Domain Number 1 Region: 1678-1833
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 1459-1582
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 381-536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000736
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 4 Region: 1587-1696
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 5 Region: 618-722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000785
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 546-654
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 7 Region: 1046-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 8 Region: 2127-2225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000331
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 9 Region: 1372-1471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000192
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 734-862
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000187
Family Spectrin repeat 0.017
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014498
Domain Number - Region: 1184-1298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00019
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1293-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000733
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 68-203
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00149
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 305-391
Classification Level Classification E-value
Superfamily Spectrin repeat 0.016
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014498   Gene: ENSOANG00000009104   Transcript: ENSOANT00000014501
Sequence length 2340
Comment pep:novel supercontig:OANA5:Contig283:898354:964017:1 gene:ENSOANG00000009104 transcript:ENSOANT00000014501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDTLVGDGSLNLEKKLFDLLLAIICCLSNMEEMLRASSLPSEDAVLQQAHFEALSSELR
NLQADVRDKKDELLKTVTRSGKRSDVFCECFDHLQTQLQLTQAAATSQSQMIKAGLDQNS
HYQNEIRLLCDQLTEKKSTLQRSLKQISGQSVGEQLQIMDACALELQNYERQVAKLKDEG
EKHCLPDVLIQEVYKLEDGLDDLWGVVRAEHPDLKSPFNLESQAEGLLRGLGEFMVIARE
KLAHDQRLQTRSKVALQTQLQSHKKFFQKLIADMLLMETHFNRAPHFVLQKPQLLWAEQV
KEVTLLEQQAHQRGTQLESLLQEWEEFDENNASLEKDLEALASSLPSVSLVEETEERLME
RIALYQQIKRSIDEKHAQLYQTVNEGKQLVSAVGCSALESQIAKLEEQWLSLTQKVDHEL
HRLQTLLKHLVSYNQNSGALIKWLESAQQTLNYWKEQSLNVSQDLETIRENINRFFDFTK
EVDEKSSLKTSVISTGNQLLHLKETDTATLRASLAQFEQKWAMLITQLPDIQEKLHQLQM
EKLPSQRAITETMTWMKNVEGHMEDETDVDSQSTVSQVKNLLQKYKVFRMEMNYKQWIVD
FVNQSLLQLSTCDVESKRYERTEFAEQLGEMNRQWHRLHGTLNKKIQYLEQFLENITENE
NKMQTLSSWMEAQGERLKTLQKPASIISVQKTLLDCQELENQLAAKAKSLNELRESYEVL
DRGRGAVLRDSVSQVAGLYQMRSELLSQVTALKAYMQSVLQHWRVYDKLYKEVNVVTIQF
WYCVEHSKSDVISLEALRRQVKNLQVLQEEAERSEGSWDRLQEAVVQLKDCCPSFSKIVE
QKFQGARSRWTLVNHEVAEQLQWAQALSQLWESYVTSLTEAMAKLQLQEEKYNQLLAVKT
SESNTAEILTQKLQDVKELQQDLQSTREAFLQNSTLVDQLLQRAGPTAQGVLSHHSYSLQ
RISYLEKMLLIKSNEFEFVLSQLRDFKDRLESLEGHIKDPVKSLDQLSLQGEGENPEPTL
NHMLALTALSPDIEYLNKESFKLPLSDVTVKTLHNLNRQWAQATAAAVEQCSEVQGIQSK
EKKFLQKYEKWVEFVEKMEETLKMNIAGRPEDLLEQQKIFEMLQGEISVNQHIASSVTIQ
SLQLLEAAQIENRTEFISKLTMLKEMWQSVTLRAQQRKNDIDGLVKQWQGFNTLLKNLMR
FLNGTIHFLTAIKSQDCYRLCEIISLIHDLKNKEIIFQRMQIPYSLTLTAGEQLLNTSDP
ETKNSLEMKIKLLQDEWKTTRLQLEEELKRLRNIVETWDRCEKQIKELGSRLQILKEKIK
APLPEQHDELYKDKELIKELETSLSTWAPNLQEVRTPKAALARLLLEEDVLACEEQIERL
HGQWEELCNRVSLRKQEVEDRLNTWALFSEKNTELCAWLVQMENKVLQTADISIEEMIEK
LQKDCVEEINLFSENKLHLKQMGEQLLKASSAARVTEIDDKLNKMNDRWQHLFDVIGSRV
KKLKETFAFIQQLDRNMSSLRTWLARVESELSKPVVYDICDDQEIQRRLAEQQDLQRDIE
QHSAGVESVFSLCDILLHDPDACANETECDSIQQTTRSLDRRWRNICAMSMERRLKIEET
WRLWQKFLDDCSRFEDWLQSAERTSALPNSSEVLYTNAKEELKKFEAFQRQIHERLTQLE
LINKQYRRLARENRTDSASKLKQRVHEGNRRWDGLQKRVAAILRRLRHFTNQREEFEGTR
ESILVWLTEMDLQLTNVEHFSASDAVEKMRQLNGFQQEITLNTNKIDQLIVFGEQLIQKS
EPMDAVVIEDELEELHRYCQEVFGRVSRFYRRLTFRHPSGRKCRHLHSHSRTLFPGTTAE
VGFSSHPEARATYRGSGLKGLCSGLTELCPPKERFFLSGERVQCRSSGTQSLPTGSFHTE
GFGGGVNIKVHKEYHPFIDDAEGRGIEDGESHGLSDTKGEGVPGQKEDVSMGLVVRWSKL
RYKEYFDTLLWATLSLFPKAGFTDISSSSSSRASLTVQGLPPAFLPSALGPSHTEQIFWV
GAVGCHPLCLLGLVNPPSGLFFPIPTSWETLFSQKCCLLPSQPPVYSPTNPRASSPVTSS
HILALPLILCSTPPPAQSFSFHSKRGRDFHRSSQNLLLWLAEAEKRHCLAQISDPHADPH
ALLESQKEFMELEKELSERQLQVNALQEISAFLLVKGDGEEYIEADEKIHVIQQKLKRLL
EKVSQDLKSTQGLLCVCDLSRTNFKVLISELRSFCFQQGGAEGTLEGKVKKDSRVERSCE
PGPGSAQRRSFLCRVIRAALPVQVLFLLLLLLACMVPSSEEDYSCTQANNFARSFYPMLS
Download sequence
Identical sequences F7G1S0
ENSOANP00000014498 ENSOANP00000014498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]